NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS4214.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
4214.1 Public Homo sapiens 5 DNAJC18 22 109 92 CCDS HistoryNCBI Gene:202052Re-query CCDS DB by CCDS ID:4214.1Re-query CCDS DB by GeneID:202052See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 4214.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000302060.9 ENSP00000302843.5 Accepted alive Link to Ensembl Transcript Viewer:ENST00000302060.9Link to Ensembl Protein Viewer:ENSP00000302843.5Re-query CCDS DB by Nucleotide ID:ENST00000302060Re-query CCDS DB by Protein ID:ENSP00000302843
Original member NCBI NM_152686.3 NP_689899.1 Updated not alive Link to Nucleotide Sequence:NM_152686.3Link to Protein Sequence:NP_689899.1Re-query CCDS DB by Nucleotide ID:NM_152686Re-query CCDS DB by Protein ID:NP_689899
Current member NCBI NM_152686.4 NP_689899.1 Accepted alive Link to Nucleotide Sequence:NM_152686.4Link to Protein Sequence:NP_689899.1Re-query CCDS DB by Nucleotide ID:NM_152686Re-query CCDS DB by Protein ID:NP_689899Link to BLAST:NP_689899.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_689899.1 358 Q9H819 358 100% 0 0

Chromosomal Locations for CCDS 4214.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 5 (NC_000005.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 139414148 139414272 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 139420053 139420225 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 139422708 139422817 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 139425005 139425114 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 139426172 139426357 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 139428538 139428683 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 139437372 139437558 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 139439406 139439445 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1077 nt):
ATGGCGGCGACTCTGGGCAGCGGGGAGCGCTGGACGGAAGCTTACATTGACGCAGTTAGAAGAAACAAAT
AC
CCAGAAGACACACCTCCTGAGAGTCATGACCCCTGTGGCTGCTGTAACTGCATGAAGGCACAAAAGGA
A
AAGAAGTCTGAGAATGAGTGGACTCAGACCCGGCAGGGTGAGGGGAACTCCACGTATAGTGAGGAACAG
CTG
CTTGGGGTACAAAGGATCAAGAAATGCAGAAATTACTATGAAATTCTGGGAGTTTCTCGAGATGCTA
GT
GACGAAGAGCTTAAGAAAGCTTACAGAAAACTCGCCCTGAAATTTCACCCTGACAAGAACTGTGCTCC
T
GGAGCAACAGATGCTTTCAAAGCAATAGGAAATGCATTTGCAGTCCTGAGCAATCCTGATAAGAGACTT
CGC
TATGATGAATACGGAGATGAACAGGTGACTTTCACTGCCCCTCGAGCCAGACCTTATAATTATTACA
GG
GATTTTGAAGCTGACATCACTCCAGAAGAGCTGTTCAACGTCTTCTTTGGAGGACATTTTCCTACAGG
A
AATATTCATATGTTTTCAAATGTGACAGATGACACTTACTATTACCGTCGACGGCACCGACATGAGAGG
ACA
CAGACTCAGAAGGAGGAGGAAGAAGAGAAACCTCAGACTACATATTCTGCATTTATTCAGCTACTTC
CA
GTTCTTGTGATTGTGATTATATCTGTCATTACTCAGCTGCTGGCTACTAATCCCCCATATAGTCTGTT
C
TATAAATCGACCTTGGGCTACACCATTTCTAGAGAAACTCAGAACCTGCAGGTGCCTTACTTTGTGGAT
AAA
AACTTTGACAAGGCCTACAGAGGAGCTTCTCTGCATGACTTGGAGAAAACAATAGAGAAGGATTACA
TT
GATTATATCCAGACTAGTTGTTGGAAGGAGAAACAACAAAAGTCAGAGCTGACAAATTTGGCAGGATT
A
TACAGAGATGAACGATTGAAACAGAAAGCAGAGTCGCTGAAACTTGAAAACTGTGAGAAACTTTCCAAA
CTC
ATTGGCCTACGCAGAGGTGGCTGA


Translation (358 aa):
MAATLGSGERWTEAYIDAVRRNKYPEDTPPESHDPCGCCNCMKAQKEKKSENEWTQTRQGEGNSTYSEEQ
L
LGVQ
RIKKCRNYYEILGVSRDASDEELKKAYRKLALKFHPDKNCAPGATDAFKAIGNAFAVLSNPDKRL
R
YDEYGDEQVTFTAPRARPYNYYRDFEADITPEELFNVFFGGHFPT
GNIHMFSNVTDDTYYYRRRHRHER
T
QTQKEEEEEKPQ
TTYSAFIQLLPVLVIVIISVITQLLATNPPYSLFYKSTLGYTISRETQNLQVPYFVD
K
NFDKAYRGASLHDLEKTIEKDYIDYIQTSCWKEKQQ
KSELTNLAGLYRDERLKQKAESLKLENCEKLSK
L
IGLRRGG




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser