NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS32704.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
32704.1 Public Homo sapiens 17 DDX42 22 109 92 CCDS HistoryNCBI Gene:11325Re-query CCDS DB by CCDS ID:32704.1Re-query CCDS DB by GeneID:11325See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 32704.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000389924.6 ENSP00000374574.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000389924.6Link to Ensembl Protein Viewer:ENSP00000374574.2Re-query CCDS DB by Nucleotide ID:ENST00000389924Re-query CCDS DB by Protein ID:ENSP00000374574
Original member Current member EBI,WTSI ENST00000583590.5 ENSP00000463561.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000583590.5Link to Ensembl Protein Viewer:ENSP00000463561.1Re-query CCDS DB by Nucleotide ID:ENST00000583590Re-query CCDS DB by Protein ID:ENSP00000463561
Original member Current member EBI,WTSI ENST00000578681.5 ENSP00000464050.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000578681.5Link to Ensembl Protein Viewer:ENSP00000464050.1Re-query CCDS DB by Nucleotide ID:ENST00000578681Re-query CCDS DB by Protein ID:ENSP00000464050
Original member Current member NCBI NM_007372.3 NP_031398.2 Accepted alive Link to Nucleotide Sequence:NM_007372.3Link to Protein Sequence:NP_031398.2Re-query CCDS DB by Nucleotide ID:NM_007372Re-query CCDS DB by Protein ID:NP_031398Link to BLAST:NP_031398.2
Original member NCBI NM_203499.2 NP_987095.1 Updated not alive Link to Nucleotide Sequence:NM_203499.2Link to Protein Sequence:NP_987095.1Re-query CCDS DB by Nucleotide ID:NM_203499Re-query CCDS DB by Protein ID:NP_987095
Current member NCBI NM_203499.3 NP_987095.1 Accepted alive Link to Nucleotide Sequence:NM_203499.3Link to Protein Sequence:NP_987095.1Re-query CCDS DB by Nucleotide ID:NM_203499Re-query CCDS DB by Protein ID:NP_987095Link to BLAST:NP_987095.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_031398.2 938 Q86XP3-1 938 100% 0 0
NP_987095.1 938 Q86XP3-1 938 100% 0 0

Chromosomal Locations for CCDS 32704.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 17 (NC_000017.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 63787050 63787270 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 63792412 63792562 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 63798038 63798099 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 63799589 63799625 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 63800468 63800617 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 63805071 63805175 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 63806535 63806654 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 63807724 63807900 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 63808820 63808948 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 63809560 63809659 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 63810513 63810560 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 63811076 63811173 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 63811932 63812208 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 63813228 63813454 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 63815563 63815673 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 63816868 63816966 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 63817694 63818398 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2817 nt):
ATGAACTGGAATAAAGGTGGTCCTGGCACTAAGCGAGGATTTGGCTTTGGAGGTTTTGCCATCAGTGCTG
GG
AAAAAGGAGGAACCCAAACTCCCACAGCAGTCCCACAGTGCCTTTGGGGCAACCAGCTCTTCTTCTGG
A
TTTGGAAAGTCAGCTCCACCACAGCTTCCTTCTTTCTACAAAATTGGATCTAAGCGGGCCAACTTTGAT
GAA
GAAAATGCCTATTTTGAAGATGAGGAAGAAGATTCTAGCAACGTTGATTTACCTTACATTCCTGCTG
AA
AACTCACCAACTCGCCAGCAATTCCATTCCAAGCCAGTAGATTCTGACAGCGATGATGATCCCTTGGA
G
GCATTCATGGCTGAAGTGGAGGATCAGGCAGCTAGAGACATGAAGAGGCTTGAAGAAAAGGACAAGGAA
AGA
AAAAACGTAAAGGGTATTCGAGATGACATTGAAGAGGAAGATGACCAAGAAGCTTATTTTCGATACA
TG
GCAGAAAACCCAACTGCTGGTGTGGTTCAGGAGGAAGAGGAAGACAATCTAGAATATGATAGTGACGG
A
AATCCAATTGCACCTACCAAAAAAATCATTGATCCTCTTCCCCCCATTGATCATTCAGAGATTGACTAT
CCA
CCATTTGAAAAAAACTTTTACAATGAGCATGAAGAGATAACCAACCTCACTCCACAGCAGTTAATAG
AT
CTCCGGCATAAGCTCAATCTTCGGGTCTCTGGTGCTGCACCTCCTAGACCAGGAAGTAGCTTTGCTCA
T
TTTGGGTTTGACGAACAACTTATGCACCAGATTCGGAAATCTGAATACACACAGCCCACTCCAATACAG
TGC
CAGGGTGTGCCTGTGGCATTAAGTGGTAGAGACATGATTGGTATTGCCAAAACAGGTAGTGGGAAAA
CT
GCAGCCTTCATTTGGCCCATGTTGATTCATATAATGGACCAGAAGGAGTTGGAACCAGGTGATGGACC
A
ATTGCAGTGATTGTGTGTCCTACCAGGGAGCTTTGCCAGCAGATCCATGCAGAATGTAAGCGGTTTGGA
AAA
GCATATAATCTTCGATCAGTGGCCGTATATGGAGGAGGGAGTATGTGGGAGCAGGCCAAGGCCCTTC
AG
GAGGGGGCAGAGATTGTTGTGTGTACCCCAGGTCGACTGATAGATCATGTGAAAAAGAAAGCTACCAA
T
CTTCAAAGAGTCTCTTACCTTGTGTTTGATGAAGCAGATCGAATGTTTGACATGGGATTTGAGTACCAA
GTT
CGATCCATAGCAAGTCATGTTCGTCCTGACAGGCAGACTCTCTTATTTAGTGCAACTTTTCGGAAGA
AG
ATTGAAAAGTTGGCCAGAGACATCCTGATCGACCCTATTCGAGTGGTGCAGGGAGATATTGGAGAGGC
A
AATGAAGATGTGACACAGATTGTGGAGATTCTCCATTCTGGACCTAGTAAATGGAACTGGCTTACCCGG
CGT
CTGGTAGAATTTACCTCTTCAGGGAGTGTCCTCCTCTTTGTTACTAAAAAAGCCAATGCTGAAGAGC
TA
GCGAATAACCTTAAACAGGAGGGTCATAATCTTGGGCTGCTCCATGGGGATATGGATCAGAGTGAGAG
A
AACAAGGTCATTTCAGACTTTAAGAAAAAGGACATCCCAGTCCTGGTGGCCACAGATGTTGCAGCCCGT
GGT
CTGGACATTCCTTCAATTAAGACTGTCATTAACTATGATGTGGCACGAGACATTGATACCCACACGC
AT
AGGATTGGCCGCACAGGAAGAGCGGGTGAGAAAGGTGTGGCCTATACCCTACTCACTCCCAAGGACAG
C
AATTTTGCTGGTGACCTGGTCCGGAACTTGGAAGGAGCCAATCAACACGTTTCTAAGGAACTCCTAGAT
CTG
GCAATGCAGAATGCCTGGTTTCGGAAATCTCGATTCAAAGGAGGGAAAGGAAAAAAGCTGAACATTG
GT
GGAGGAGGCCTAGGCTACAGGGAGCGGCCTGGCCTGGGCTCTGAGAACATGGATCGAGGAAATAACAA
T
GTAATGAGCAATTATGAGGCCTACAAGCCTTCCACAGGAGCTATGGGAGATCGACTAACGGCAATGAAA
GCA
GCTTTCCAGTCACAGTACAAGAGTCACTTTGTTGCAGCCAGTTTAAGTAATCAGAAGGCTGGAAGTT
CT
GCTGCTGGGGCAAGTGGGTGGACTAGTGCAGGGAGCTTGAATTCTGTTCCAACTAACTCAGCACAACA
G
GGCCATAACAGTCCTGACAGCCCCGTCACCAGTGCCGCCAAGGGCATCCCAGGCTTTGGCAATACTGGC
AAC
ATCAGTGGTGCCCCTGTGACCTACCCGTCTGCCGGAGCCCAAGGAGTCAACAACACAGCTTCAGGGA
AT
AACAGCCGAGAAGGGACTGGGGGCAGCAACGGGAAAAGAGAGAGATATACTGAGAACCGGGGCAGCAG
C
CGTCACAGTCACGGAGAGACTGGCAATCGGCATAGCGATAGTCCACGTCACGGAGATGGTGGTCGCCAT
GGA
GATGGATACCGCCATCCAGAAAGCAGCAGCCGTCATACTGATGGCCATCGGCACGGGGAGAACAGAC
AT
GGAGGAAGCGCAGGCCGGCATGGGGAGAACCGGGGTGCAAATGATGGTCGGAATGGGGAAAGCAGGAA
A
GAAGCTTTTAATCGTGAGAGCAAGATGGAGCCCAAGATGGAACCCAAAGTGGACAGCAGCAAGATGGAC
AAG
GTGGACAGCAAGACAGATAAGACAGCTGACGGCTTTGCTGTCCCAGAGCCGCCTAAACGCAAGAAAA
GT
CGATGGGACAGTTAG


Translation (938 aa):
MNWNKGGPGTKRGFGFGGFAISAGKKEEPKLPQQSHSAFGATSSSSGFGKSAPPQLPSFYKIGSKRANFD
E
EN
AYFEDEEEDSSNVDLPYIPAENSPTRQQFHSKPVDSDSDDDPLEAFMAEVEDQAARDMKRLEEKDKE
R
KNV
KGIRDDIEEEDDQEAYFRYMAENPTAGVVQEEEEDNLEYDSDGNPIAPTKKIIDPLPPIDHSEIDY
P
PFEKNFYNEHEEITNLTPQQLIDLRHKLNLR
VSGAAPPRPGSSFAHFGFDEQLMHQIRKSEYTQPTPIQ
C
Q
GVPVALSGRDMIGIAKTGSGKTAAFIWPMLIHIMDQKELEPGDGPIAVIVCPTRELCQQIHAECKRFG
K
AYNLRSVAVYGGGSMWEQAKALQEGAEIVVCTP
GRLIDHVKKKATNLQRVSYLVFDEADRMFDMGFEYQ
V
RSIASHVRPDRQ
TLLFSATFRKKIEKLARDILIDPIRVVQGDIGEANEDVTQIVEILHSGPSKWNWLTR
R
LVEFTSSGSVLLFVTKKANAEELANNLKQEGHNLGLLHGDMDQSERNKVISDFKKKDIPVLVATDVA
AR
G
LDIPSIKTVINYDVARDIDTHTHRIGRTGRAGEKGVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLD
L
AMQ
NAWFRKSRFKGGKGKKLNIGGGGLGYRERPGLGSENMDRGNNNVMSNYEAYKPSTGAMGDRLTAMK
A
AFQ
SQYKSHFVAASLSNQKAGSSAAGASGWTSAGSLNSVPTNSAQQGHNSPDSPVTSAAKGIPGFGNTG
N
ISGAPVTYPSAGAQGVNNTASGNNSREGTGGSNGKRERYTENRGSSRHSHGETGNRHSDSPRHGDGGRH
G
DGYRHPESSSRHTDGHRHGENRHGGSAGRHGENRGANDGRNGESRKEAFNRESKMEPKMEPKVDSSKMD
K
VDSKTDKTADGFAVPEPPKRKKSRWDS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser