NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS7686.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
7686.1 Public Homo sapiens 10 CYP2E1 22 109 92 CCDS HistoryNCBI Gene:1571Re-query CCDS DB by CCDS ID:7686.1Re-query CCDS DB by GeneID:1571See the combined annotation on chromosome 10 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 7686.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000252945.7 ENSP00000252945.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000252945.7Link to Ensembl Protein Viewer:ENSP00000252945.3Re-query CCDS DB by Nucleotide ID:ENST00000252945Re-query CCDS DB by Protein ID:ENSP00000252945
Original member Current member EBI,WTSI ENST00000463117.6 ENSP00000440689.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000463117.6Link to Ensembl Protein Viewer:ENSP00000440689.1Re-query CCDS DB by Nucleotide ID:ENST00000463117Re-query CCDS DB by Protein ID:ENSP00000440689
Original member Current member NCBI NM_000773.3 NP_000764.1 Accepted alive Link to Nucleotide Sequence:NM_000773.3Link to Protein Sequence:NP_000764.1Re-query CCDS DB by Nucleotide ID:NM_000773Re-query CCDS DB by Protein ID:NP_000764Link to BLAST:NP_000764.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000764.1 493 P05181 493 100% 0 0

Chromosomal Locations for CCDS 7686.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 10 (NC_000010.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10See the combined annotation on chromosome 10 in Sequence Viewer

Chromosome Start Stop Links
10 133527396 133527572 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 133528481 133528640 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 133531585 133531734 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 133532124 133532284 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 133532692 133532868 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 133533756 133533897 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 133537063 133537250 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 133537751 133537892 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 133538780 133538964 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1482 nt):
ATGTCTGCCCTCGGAGTCACCGTGGCCCTGCTGGTGTGGGCGGCCTTCCTCCTGCTGGTGTCCATGTGGA
GG
CAGGTGCACAGCAGCTGGAATCTGCCCCCAGGCCCTTTCCCGCTTCCCATCATCGGGAACCTCTTCCA
G
TTGGAATTGAAGAATATTCCCAAGTCCTTCACCCGGTTGGCCCAGCGCTTCGGGCCGGTGTTCACGCTG
TAC
GTGGGCTCGCAGCGCATGGTGGTGATGCACGGCTACAAGGCGGTGAAGGAAGCGCTGCTGGACTACA
AG
GACGAGTTCTCGGGCAGAGGCGACCTCCCCGCGTTCCATGCGCACAGGGACAGGGGAATCATTTTTAA
T
AATGGACCTACCTGGAAGGACATCCGGCGGTTTTCCCTGACCACCCTCCGGAACTATGGGATGGGGAAA
CAG
GGCAATGAGAGCCGGATCCAGAGGGAGGCCCACTTCCTGCTGGAAGCACTCAGGAAGACCCAAGGCC
AG
CCTTTCGACCCCACCTTCCTCATCGGCTGCGCGCCCTGCAACGTCATAGCCGACATCCTCTTCCGCAA
G
CATTTTGACTACAATGATGAGAAGTTTCTAAGGCTGATGTATTTGTTTAATGAGAACTTCCACCTACTC
AGC
ACTCCCTGGCTCCAGCTTTACAATAATTTTCCCAGCTTTCTACACTACTTGCCTGGAAGCCACAGAA
AA
GTCATAAAAAATGTGGCTGAAGTAAAAGAGTATGTGTCTGAAAGGGTGAAGGAGCACCATCAATCTCT
G
GACCCCAACTGTCCCCGGGACCTCACCGACTGCCTGCTCGTGGAAATGGAGAAGGAAAAGCACAGTGCA
GAG
CGCTTGTACACAATGGACGGTATCACCGTGACTGTGGCCGACCTGTTCTTTGCGGGGACAGAGACCA
CC
AGCACAACTCTGAGATATGGGCTCCTGATTCTCATGAAATACCCTGAGATCGAAGAGAAGCTCCATGA
A
GAAATTGACAGGGTGATTGGGCCAAGCCGAATCCCTGCCATCAAGGATAGGCAAGAGATGCCCTACATG
GAT
GCTGTGGTGCATGAGATTCAGCGGTTCATCACCCTCGTGCCCTCCAACCTGCCCCATGAAGCAACCC
GA
GACACCATTTTCAGAGGATACCTCATCCCCAAGGGCACAGTCGTAGTGCCAACTCTGGACTCTGTTTT
G
TATGACAACCAAGAATTTCCTGATCCAGAAAAGTTTAAGCCAGAACACTTCCTGAATGAAAATGGAAAG
TTC
AAGTACAGTGACTATTTCAAGCCATTTTCCACAGGAAAACGAGTGTGTGCTGGAGAAGGCCTGGCTC
GC
ATGGAGTTGTTTCTTTTGTTGTGTGCCATTTTGCAGCATTTTAATTTGAAGCCTCTCGTTGACCCAAA
G
GATATCGACCTCAGCCCTATACATATTGGGTTTGGCTGTATCCCACCACGTTACAAACTCTGTGTCATT
CCC
CGCTCATGA


Translation (493 aa):
MSALGVTVALLVWAAFLLLVSMWRQVHSSWNLPPGPFPLPIIGNLFQLELKNIPKSFTRLAQRFGPVFTL
Y
VGSQRMVVMHGYKAVKEALLDYKDEFSGRGDLPAFHAHRDR
GIIFNNGPTWKDIRRFSLTTLRNYGMGK
Q
GNESRIQREAHFLLEALRKTQ
GQPFDPTFLIGCAPCNVIADILFRKHFDYNDEKFLRLMYLFNENFHLL
S
TPWLQ
LYNNFPSFLHYLPGSHRKVIKNVAEVKEYVSERVKEHHQSLDPNCPRDLTDCLLVEMEKEKHSA
E
RLYTMDGITVTVADLFFAGTETTSTTLRYGLLILMKYPEIE
EKLHEEIDRVIGPSRIPAIKDRQEMPYM
D
AVVHEIQRFITLVPSNLPHEATRDTIFRGYLIPK
GTVVVPTLDSVLYDNQEFPDPEKFKPEHFLNENGK
F
KYSDYFKPFST
GKRVCAGEGLARMELFLLLCAILQHFNLKPLVDPKDIDLSPIHIGFGCIPPRYKLCVI
P
RS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser