NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS3500.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
3500.1 Public Homo sapiens 4 CLOCK 22 109 92 CCDS HistoryNCBI Gene:9575Re-query CCDS DB by CCDS ID:3500.1Re-query CCDS DB by GeneID:9575See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 3500.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000309964.8 ENSP00000308741.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000309964.8Link to Ensembl Protein Viewer:ENSP00000308741.4Re-query CCDS DB by Nucleotide ID:ENST00000309964Re-query CCDS DB by Protein ID:ENSP00000308741
Original member Current member EBI,WTSI ENST00000381322.5 ENSP00000370723.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000381322.5Link to Ensembl Protein Viewer:ENSP00000370723.1Re-query CCDS DB by Nucleotide ID:ENST00000381322Re-query CCDS DB by Protein ID:ENSP00000370723
Original member Current member EBI,WTSI ENST00000513440.5 ENSP00000426983.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000513440.5Link to Ensembl Protein Viewer:ENSP00000426983.1Re-query CCDS DB by Nucleotide ID:ENST00000513440Re-query CCDS DB by Protein ID:ENSP00000426983
Original member Current member NCBI NM_001267843.1 NP_001254772.1 Accepted alive Link to Nucleotide Sequence:NM_001267843.1Link to Protein Sequence:NP_001254772.1Re-query CCDS DB by Nucleotide ID:NM_001267843Re-query CCDS DB by Protein ID:NP_001254772Link to BLAST:NP_001254772.1
Original member Current member NCBI NM_004898.3 NP_004889.1 Accepted alive Link to Nucleotide Sequence:NM_004898.3Link to Protein Sequence:NP_004889.1Re-query CCDS DB by Nucleotide ID:NM_004898Re-query CCDS DB by Protein ID:NP_004889Link to BLAST:NP_004889.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001254772.1 846 O15516 846 100% 0 0
NP_004889.1 846 O15516 846 100% 0 0

Chromosomal Locations for CCDS 3500.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 4 (NC_000004.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 55435415 55435594 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 55438282 55438537 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 55442432 55442634 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 55443687 55443896 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 55444633 55444785 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 55448779 55448868 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 55449396 55449496 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 55450091 55450232 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 55453054 55453129 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 55453677 55453824 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 55455897 55456003 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 55456218 55456300 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 55458892 55459010 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 55459148 55459261 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 55463685 55463805 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 55470717 55470806 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 55475963 55476054 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 55478815 55478963 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 55479640 55479699 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 55482739 55482785 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2541 nt):
ATGTTGTTTACCGTAAGCTGTAGTAAAATGAGCTCGATTGTTGACAGAGATGACAGTAGTATTTTTGATG
GG
TTGGTGGAAGAAGATGACAAGGACAAAGCGAAAAGAGTATCTAGAAACAAATCTGAAAAGAAACGTAG
A
GATCAATTTAATGTTCTCATTAAAGAACTGGGATCCATGCTTCCTGGTAATGCTAGAAAGATGGACAAA
TCT
ACTGTTCTGCAGAAAAGCATTGATTTTTTACGAAAACATAAAGAAATCACTGCACAGTCAGATGCTA
GT
GAAATTCGACAGGACTGGAAACCTACATTCCTTAGTAATGAAGAGTTTACACAATTAATGTTAGAGGC
T
CTTGATGGTTTTTTTTTAGCAATCATGACAGATGGAAGCATAATATATGTGTCTGAGAGTGTAACTTCA
TTA
CTTGAACATTTACCATCTGATCTTGTGGATCAAAGTATATTTAATTTTATCCCAGAAGGGGAACATT
CA
GAGGTTTATAAAATACTCTCTACTCATCTGCTGGAAAGTGATTCATTAACCCCAGAATATTTAAAATC
A
AAAAATCAGTTAGAATTCTGTTGTCACATGCTGCGAGGAACAATAGACCCAAAGGAGCCATCTACCTAT
GAA
TATGTAAAATTTATAGGAAATTTCAAATCTTTAAACAGTGTATCCTCTTCAGCACACAATGGTTTTG
AA
GGAACTATACAACGCACACATAGGCCATCTTATGAAGATAGAGTTTGTTTTGTAGCTACTGTCAGGTT
A
GCTACACCTCAGTTCATCAAGGAAATGTGCACTGTTGAAGAACCCAATGAAGAGTTTACATCTAGACAT
AGT
TTAGAATGGAAGTTTCTGTTTCTAGATCACAGGGCACCACCCATAATAGGGTATTTGCCATTTGAAG
TT
CTGGGAACATCAGGCTATGATTACTATCATGTGGATGACCTAGAAAATTTGGCAAAATGTCATGAGCA
C
TTAATGCAATATGGGAAAGGCAAATCATGTTATTATAGGTTCCTGACTAAGGGGCAACAGTGGATTTGG
CTT
CAGACTCATTATTATATCACTTACCATCAGTGGAATTCAAGGCCAGAGTTTATTGTTTGTACTCACA
CT
GTAGTAAGTTATGCAGAAGTTAGGGCTGAAAGACGACGAGAACTTGGCATTGAAGAGTCTCTTCCTGA
G
ACAGCTGCTGACAAAAGCCAAGATTCTGGGTCAGATAATCGTATAAACACAGTCAGTCTCAAGGAAGCA
TTG
GAAAGGTTTGATCACAGCCCAACCCCTTCTGCCTCTTCTCGGAGTTCAAGAAAATCATCTCACACGG
CC
GTCTCAGACCCTTCCTCAACACCAACCAAGATCCCGACGGATACGAGCACTCCACCCAGGCAGCATTT
A
CCAGCTCATGAGAAGATGGTGCAAAGAAGGTCATCATTTAGTAGTCAGTCCATAAATTCCCAGTCTGTT
GGT
TCATCATTAACACAGCCAGTGATGTCTCAAGCTACAAATTTACCAATTCCACAAGGCATGTCCCAGT
TT
CAGTTTTCAGCTCAATTAGGAGCCATGCAACATCTGAAAGACCAATTGGAACAACGGACACGCATGAT
A
GAAGCAAATATTCATCGGCAACAAGAAGAACTAAGAAAAATTCAAGAACAACTTCAGATGGTCCATGGT
CAG
GGGCTGCAGATGTTTTTGCAACAATCAAATCCTGGGTTGAATTTTGGTTCCGTTCAACTTTCTTCTG
GA
AATTCATCTAATATCCAGCAACTTGCACCTATAAATATGCAAGGCCAAGTTGTTCCTACTAACCAGAT
T
CAAAGTGGAATGAATACTGGACACATTGGCACAACTCAGCACATGATACAACAACAGACTTTACAGAGT
ACA
TCAACTCAGAGTCAACAAAATGTACTGAGTGGGCACAGTCAGCAAACATCTCTACCCAGTCAGACAC
AG
AGCACTCTTACAGCCCCACTGTATAACACTATGGTGATTTCTCAGCCTGCAGCCGGAAGCATGGTCCA
G
ATTCCATCTAGTATGCCACAAAACAGCACCCAGAGTGCTGCAGTAACTACATTCACTCAGGACAGGCAG
ATA
AGATTTTCTCAAGGTCAACAACTTGTGACCAAATTAGTGACTGCTCCTGTAGCTTGTGGGGCAGTCA
TG
GTACCTAGTACTATGCTTATGGGCCAGGTGGTGACTGCATATCCTACTTTTGCTACACAACAGCAACA
G
TCACAGACATTGTCAGTAACGCAGCAGCAGCAGCAGCAGAGCTCCCAGGAGCAGCAGCTCACTTCAGTT
CAG
CAACCATCTCAGGCTCAGCTGACCCAGCCACCGCAACAATTTTTACAGACTTCTAGGTTGCTCCATG
GG
AATCCCTCAACTCAACTCATTCTCTCTGCTGCATTTCCTCTACAACAGAGCACCTTCCCTCAGTCACA
T
CACCAGCAACATCAGTCTCAGCAACAGCAGCAACTCAGCCGGCACAGGACTGACAGCTTGCCCGACCCT
TCC
AAGGTTCAACCACAGTAG


Translation (846 aa):
MLFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSMLPGNARKMDK
S
TVLQKSIDFLRKHK
EITAQSDASEIRQDWKPTFLSNEEFTQLMLEALDGFFLAIMTDGSIIYVSESVTS
L
LEHLP
SDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSLTPEYLKSKNQLEFCCHMLRGTIDPKEPSTY
E
YVKFIGNFKSLNS
VSSSAHNGFEGTIQRTHRPSYEDRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRH
S
LEWKFLFLDH
RAPPIIGYLPFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIW
L
QTHYYITYHQWNSRPEFIVCTHTVV
SYAEVRAERRRELGIEESLPETAADKSQDSGSDNRINTVSLKEA
L
ERFDHSPTPSASSRSSRKSSHTAVSDPS
STPTKIPTDTSTPPRQHLPAHEKMVQRRSSFSSQSINSQSV
G
SSLTQPVMSQATNLPIPQGMSQ
FQFSAQLGAMQHLKDQLEQRTRMIEANIHRQQEELRKIQEQLQMVHG
Q
GLQ
MFLQQSNPGLNFGSVQLSSGNSSNIQQLAPINMQGQVVPTNQIQSGMNTGHIGTTQHMIQQQTLQS
T
STQ
SQQNVLSGHSQQTSLPSQTQSTLTAPLYNTMVISQPAAGSMVQIPSSMPQNSTQSAAVTTFTQDRQ
I
RFSQGQQLVTKLVTAPVACGAVMVPSTMLMGQVVTAYPTFATQQQQSQTLSVTQQQQQQSSQEQQLTSV
Q
QPSQAQLTQPPQQFLQ
TSRLLHGNPSTQLILSAAFPLQQSTFPQSHHQQHQSQQQQQLSRHRTDSLPDP
S
KVQPQ




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser