NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS34671.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
34671.1 Public Homo sapiens 7 CCDC146 22 109 92 CCDS HistoryNCBI Gene:57639Re-query CCDS DB by CCDS ID:34671.1Re-query CCDS DB by GeneID:57639See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 34671.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000285871.4 ENSP00000285871.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000285871.4Link to Ensembl Protein Viewer:ENSP00000285871.4Re-query CCDS DB by Nucleotide ID:ENST00000285871Re-query CCDS DB by Protein ID:ENSP00000285871
Original member Current member NCBI NM_020879.2 NP_065930.2 Accepted alive Link to Nucleotide Sequence:NM_020879.2Link to Protein Sequence:NP_065930.2Re-query CCDS DB by Nucleotide ID:NM_020879Re-query CCDS DB by Protein ID:NP_065930Link to BLAST:NP_065930.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_065930.2 955 Q8IYE0-1 955 100% 0 0

Chromosomal Locations for CCDS 34671.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 7 (NC_000007.14)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 77167669 77167824 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 77236947 77237029 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 77241691 77241900 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 77254506 77254563 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 77256333 77256509 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 77258995 77259068 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 77260009 77260236 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 77262121 77262307 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 77273694 77273789 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 77274482 77274652 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 77278752 77278840 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 77278937 77279101 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 77280429 77280653 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 77282557 77282785 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 77286798 77286926 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 77287440 77287577 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 77292952 77293200 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 77294663 77294866 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2868 nt):
ATGGAAGACAGTAGCACAGACACAGAAAAAGAAGAGGAAGAGGAGAAAGATGAAAAGGATCAAGAGCCCA
TT
TATGCCATAGTGCCCACAATTAACATTCAAGATGAGCGGTTTGTTGATTTATCTGAAACTCCAGCTTT
C
ATTTTTCTGCATGAGTTACATGCTATGGGAAAACTTCCTGGAACCAGAATGGCAGCGTTAAAAGCCAAG
TAT
ACCTTGCTGCATGACGCCGTGATGAGCACACAAGAGTCAGAGGTCCAACTGCTACAGAATGCCAAAC
GT
TTCACTGAGCAAATACAACAGCAGCAGTTTCACCTGCAGCAAGCTGATAATTTTCCAGAAGCATTCTC
C
ACGGAGGTCTCCAAAATGAGAGAACAACTTCTCAAGTATCAAAATGAATATAATGCAGTGAAGGAAAGA
GAG
TTCCATAATCAGTACAGATTAAATAGCTTAAAGGAAGAAAAAATCATCATAGTAAAAGAATTTGAGA
AG
ATAACAAAGCCAGGAGAAATGGAGAAGAAGATGAAAATATTGAGAGAAAGCACTGAAGAATTACGTAA
A
GAAATAATGCAGAAGAAATTAGAAATTAAAAATTTACGAGAAGATTTGGCATCTAAACAAAAGCAATTA
TTA
AAAGAGCAGAAGGAACTAGAAGAATTGTTGGGACATCAGGTCGTCCTAAAGGATGAAGTGGCCCACC
AT
CAAACCATTCCAGTACAAATTGGAAAAGAGATAGAAAAAATAACACGCAAAAAAGTAGAAATGGAAAA
G
AAAAAAATTGTCTTGGAACAAGAAGTCAAAACGCTAAATGACTCCCTAAAGAAAGTTGAAAACAAGGTT
AGT
GCTATAGTGGATGAGAAGGAAAATGTAATAAAGGAAGTTGAAGGCAAACGAGCCTTACTTGAAATCA
AA
GAACGAGAACATAACCAATTGGTCAAGCTATTGGAATTAGCCAGAGAGAATGAAGCAACTTCATTAAC
T
GAAAGAGGGATCTTGGATCTCAATTTACGCAACAGTCTCATTGACAAGCAGAACTACCATGATGAACTT
TCT
CGTAAGCAAAGAGAGAAAGAACGAGATTTTCGAAATTTAAGAAAGATGGAACTGCTCTTGAAAGTGT
CC
TGGGATGCACTTAGGCAAACTCAAGCACTGCATCAAAGGCTTCTATTAGAGATGGAAGCTATCCCCAA
A
GATGATTCTACATTATCTGAGAGAAGGCGAGAGCTTCACAAGGAAGTTGAAGTAGCTAAGAGGAATTTG
GCC
CAACAGAAAATTATATCAGAAATGGAGTCTAAGTTAGTAGAACAACAACTTGCAGAAGAAAACAAGC
TT
TTAAAGGAGCAAGAAAACATGAAAGAGCTAGTAGTCAACCTTCTCCGCATGACTCAAATCAAAATTGA
T
GAAAAGGAACAAAAGTCCAAGGATTTCCTGAAAGCTCAGCAAAAATACACCAACATTGTTAAAGAAATG
AAA
GCAAAGGATCTTGAAATCAGGATACACAAGAAGAAAAAATGTGAAATTTATCGGAGACTGAGAGAGT
TT
GCTAAACTGTATGACACCATTCGAAATGAAAGAAACAAATTTGTTAACTTACTCCACAAAGCTCATCA
G
AAAGTAAATGAAATAAAAGAAAGGCATAAAATGTCATTAAATGAACTTGAAATTCTGAGAAATAGTGCC
GTT
AGTCAAGAAAGAAAGCTACAAAATTCCATGCTGAAACACGCCAACAATGTTACCATCAGAGAGAGCA
TG
CAAAACGATGTGCGCAAAATTGTATCAAAACTTCAGGAAATGAAAGAAAAGAAGGAAGCCCAGTTAAA
T
AACATTGACAGACTTGCCAACACGATCACAATGATCGAAGAGGAGATGGTGCAGCTTCGCAAAAGATAC
GAA
AAAGCTGTTCAGCATCGAAATGAAAGTGGCGTTCAGCTGATAGAGCGGGAAGAAGAAATATGCATTT
TT
TATGAAAAAATAAATATCCAAGAGAAGATGAAACTAAATGGAGAAATTGAAATACATCTACTGGAAGA
A
AAGATCCAATTCCTGAAAATGAAGATTGCTGAGAAGCAAAGACAAATTTGTGTGACCCAGAAATTACTG
CCA
GCCAAGAGGTCCCTGGATGCCGACCTAGCTGTGCTCCAAATTCAGTTTTCACAGTGTACAGACAGAA
TT
AAAGACCTGGAGAAACAGTTCGTAAAGCCTGATGGTGAGAATAGAGCTCGCTTCCTTCCAGGGAAAGA
T
CTGACCGAAAAAGAAATGATCCAAAAATTAGACAAGCTGGAACTACAACTGGCCAAGAAGGAGGAGAAG
CTG
CTGGAGAAGGATTTCATCTATGAGCAGGTCTCCAGGCTCACAGACAGGCTCTGCAGCAAAACTCAGG
GC
TGCAAGCAGGACACACTGCTCTTAGCCAAGAAGATGAATGGCTATCAAAGAAGGATCAAAAATGCAAC
T
GAGAAAATGATGGCTCTTGTTGCTGAGCTGTCCATGAAACAAGCCCTAACCATTGAACTCCAAAAGGAA
GTC
AGGGAGAAAGAAGACTTCATCTTCACTTGCAATTCCAGGATAGAAAAAGGTCTGCCACTCAATAAGG
AA
ATTGAGAAAGAATGGTTGAAAGTCCTTCGAGATGAAGAAATGCACGCCTTGGCCATCGCTGAAAAGTC
T
CAGGAGTTCTTGGAAGCAGATAATCGCCAGCTGCCCAATGGTGTTTACACAACTGCAGAGCAGCGTCCG
AAT
GCCTACATCCCAGAAGCAGATGCCACTCTTCCTTTGCCAAAACCTTATGGTGCTTTGGCTCCTTTTA
AA
CCCAGTGAACCTGGAGCCAATATGAGGCACATAAGGAAACCTGTTATAAAGCCAGTTGAAATCTGA


Translation (955 aa):
MEDSSTDTEKEEEEEKDEKDQEPIYAIVPTINIQDERFVDLSETPAFIFLHELHAMGKLPGTRMAALKAK
Y
TLLHDAVM
STQESEVQLLQNAKRFTEQIQQQQFHLQQADNFPEAFSTEVSKMREQLLKYQNEYNAVKER
E
FHNQYRLN
SLKEEKIIIVKEFEKITKPGEMEKKMKILRESTEELRKEIMQKKLEIKNLREDLASKQKQL
L
KEQKELEELLGHQVVLK
DEVAHHQTIPVQIGKEIEKITRKKVEMEKKKIVLEQEVKTLNDSLKKVENKV
S
AIVDEKENVIKEVEGKRALLEIKEREHNQLVKLLELARENEATSLTE
RGILDLNLRNSLIDKQNYHDEL
S
RKQREKERDFRNLRKMELLLKVSWDALRQTQALHQRLLLE
MEAIPKDDSTLSERRRELHKEVEVAKRNL
A
QQ
KIISEMESKLVEQQLAEENKLLKEQENMKELVVNLLRMTQIKIDEKEQKSKDFLKAQQKYTNIVKEM
K
AKDLEIRIHKKKKCEIYR
RLREFAKLYDTIRNERNKFVNLLHKAHQKVNEIKERHKMSLNELEILRNSA
V
SQE
RKLQNSMLKHANNVTIRESMQNDVRKIVSKLQEMKEKKEAQLNNIDRLANTITMIEEEMVQLRKRY
E
KAVQHRNE
SGVQLIEREEEICIFYEKINIQEKMKLNGEIEIHLLEEKIQFLKMKIAEKQRQICVTQKLL
P
AKRSLDADLAVLQIQ
FSQCTDRIKDLEKQFVKPDGENRARFLPGKDLTEKEMIQKLDKLELQLAKKEEK
L
LEKDFIYEQVSRLTDRLCSKTQGCKQDTLLLAKK
MNGYQRRIKNATEKMMALVAELSMKQALTIELQKE
V
REKEDFIFTCNSRIEKGLPLNKEIEKEWLKVLRDEEMHALAIAEKSQ
EFLEADNRQLPNGVYTTAEQRP
N
AYIPEADATLPLPKPYGALAPFKPSEPGANMRHIRKPVIKPVEI




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser