NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS8065.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
8065.1 Public Homo sapiens 11 BAD 22 109 92 CCDS HistoryNCBI Gene:572Re-query CCDS DB by CCDS ID:8065.1Re-query CCDS DB by GeneID:572See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 8065.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000309032.7 ENSP00000309103.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000309032.7Link to Ensembl Protein Viewer:ENSP00000309103.3Re-query CCDS DB by Nucleotide ID:ENST00000309032Re-query CCDS DB by Protein ID:ENSP00000309103
Original member Current member EBI,WTSI ENST00000394532.7 ENSP00000378040.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000394532.7Link to Ensembl Protein Viewer:ENSP00000378040.3Re-query CCDS DB by Nucleotide ID:ENST00000394532Re-query CCDS DB by Protein ID:ENSP00000378040
Original member Current member NCBI NM_004322.3 NP_004313.1 Accepted alive Link to Nucleotide Sequence:NM_004322.3Link to Protein Sequence:NP_004313.1Re-query CCDS DB by Nucleotide ID:NM_004322Re-query CCDS DB by Protein ID:NP_004313Link to BLAST:NP_004313.1
Original member Current member NCBI NM_032989.2 NP_116784.1 Accepted alive Link to Nucleotide Sequence:NM_032989.2Link to Protein Sequence:NP_116784.1Re-query CCDS DB by Nucleotide ID:NM_032989Re-query CCDS DB by Protein ID:NP_116784Link to BLAST:NP_116784.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_004313.1 168 Q92934 168 100% 0 0
NP_116784.1 168 Q92934 168 100% 0 0

Chromosomal Locations for CCDS 8065.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 11 (NC_000011.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 64270209 64270337 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 64271613 64271803 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 64284182 64284368 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (507 nt):
ATGTTCCAGATCCCAGAGTTTGAGCCGAGTGAGCAGGAAGACTCCAGCTCTGCAGAGAGGGGCCTGGGCC
CC
AGCCCCGCAGGGGACGGGCCCTCAGGCTCCGGCAAGCATCATCGCCAGGCCCCAGGCCTCCTGTGGGA
C
GCCAGTCACCAGCAGGAGCAGCCAACCAGCAGCAGCCATCATGGAGGCGCTGGGGCTGTGGAGATCCGG
AGT
CGCCACAGCTCCTACCCCGCGGGGACGGAGGACGACGAAGGGATGGGGGAGGAGCCCAGCCCCTTTC
GG
GGCCGCTCGCGCTCGGCGCCCCCCAACCTCTGGGCAGCACAGCGCTATGGCCGCGAGCTCCGGAGGAT
G
AGTGACGAGTTTGTGGACTCCTTTAAGAAGGGACTTCCTCGCCCGAAGAGCGCGGGCACAGCAACGCAG
ATG
CGGCAAAGCTCCAGCTGGACGCGAGTCTTCCAGTCCTGGTGGGATCGGAACTTGGGCAGGGGAAGCT
CC
GCCCCCTCCCAGTGA


Translation (168 aa):
MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIR
S
RHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFK
KGLPRPKSAGTATQ
M
RQSSSWTRVFQSWWDRNLGRGSSAPSQ




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser