NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS46540.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
46540.1 Public Homo sapiens 2 B3GNT7 22 109 92 CCDS HistoryNCBI Gene:93010Re-query CCDS DB by CCDS ID:46540.1Re-query CCDS DB by GeneID:93010See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 6, NCBI annotation release 37.1, Ensembl annotation release 55

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 46540.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000287590.5 ENSP00000287590.5 Accepted alive Link to Ensembl Transcript Viewer:ENST00000287590.5Link to Ensembl Protein Viewer:ENSP00000287590.5Re-query CCDS DB by Nucleotide ID:ENST00000287590Re-query CCDS DB by Protein ID:ENSP00000287590
Original member Current member NCBI NM_145236.2 NP_660279.1 Accepted alive Link to Nucleotide Sequence:NM_145236.2Link to Protein Sequence:NP_660279.1Re-query CCDS DB by Nucleotide ID:NM_145236Re-query CCDS DB by Protein ID:NP_660279Link to BLAST:NP_660279.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_660279.1 401 Q8NFL0 401 100% 0 0

Chromosomal Locations for CCDS 46540.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 2 (NC_000002.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 231395804 231395814 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 231397731 231398925 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1206 nt):
ATGTCGCTGTGGAAGAAAACCGTCTACCGGAGTCTGTGCCTGGCCCTGGCCCTGCTCGTGGCCGTGACGG
TG
TTCCAACGCAGTCTCACCCCTGGTCAGTTTCTGCAGGAGCCTCCGCCACCCACCCTGGAGCCACAGAA
G
GCCCAGAAGCCAAATGGACAGCTGGTGAACCCCAACAACTTCTGGAAGAACCCGAAAGATGTGGCTGCG
CCC
ACGCCCATGGCCTCTCAGGGGCCCCAGGCCTGGGACGTGACCACCACTAACTGCTCAGCCAATATCA
AC
TTGACCCACCAGCCCTGGTTCCAGGTCCTGGAGCCGCAGTTCCGGCAGTTTCTCTTCTACCGCCACTG
C
CGCTACTTCCCCATGCTGCTGAACCACCCGGAGAAGTGCAGGGGCGATGTCTACCTGCTGGTGGTTGTC
AAG
TCGGTCATCACGCAGCACGACCGCCGCGAGGCCATCCGCCAGACCTGGGGCCGCGAGCGGCAGTCCG
CG
GGTGGGGGCCGAGGCGCCGTGCGCACCCTCTTCCTGCTGGGCACGGCCTCCAAGCAGGAGGAGCGCAC
G
CACTACCAGCAGCTGCTGGCCTACGAAGACCGCCTCTACGGCGACATCCTGCAGTGGGGCTTTCTCGAC
ACC
TTCTTCAACCTGACCCTCAAGGAGATCCACTTCCTCAAGTGGCTGGACATCTACTGCCCCCACGTCC
CC
TTCATTTTCAAAGGCGACGATGACGTCTTCGTCAACCCCACCAACCTGCTAGAATTTCTGGCTGACCG
G
CAGCCACAGGAAAACCTGTTCGTGGGCGATGTCCTGCAGCACGCTCGGCCCATTCGCAGGAAAGACAAC
AAA
TACTACATCCCGGGGGCCCTGTACGGCAAGGCCAGCTATCCGCCGTATGCAGGCGGCGGTGGCTTCC
TC
ATGGCCGGCAGCCTGGCCCGGCGCCTGCACCATGCCTGCGACACCCTGGAGCTCTACCCGATCGACGA
C
GTCTTTCTGGGCATGTGCCTGGAGGTGCTGGGCGTGCAGCCCACGGCCCACGAGGGCTTCAAGACTTTC
GGC
ATCTCCCGGAACCGCAACAGCCGCATGAACAAGGAGCCGTGCTTTTTCCGCGCCATGCTCGTGGTGC
AC
AAGCTGCTGCCCCCTGAGCTGCTCGCCATGTGGGGGCTGGTGCACAGCAATCTCACCTGCTCCCGCAA
G
CTCCAGGTGCTCTGA


Translation (401 aa):
MSLWKKTVYRSLCLALALLVAVTVFQRSLTPGQFLQEPPPPTLEPQKAQKPNGQLVNPNNFWKNPKDVAA
P
TPMASQGPQAWDVTTTNCSANINLTHQPWFQVLEPQFRQFLFYRHCRYFPMLLNHPEKCRGDVYLLVVV
K
SVITQHDRREAIRQTWGRERQSAGGGRGAVRTLFLLGTASKQEERTHYQQLLAYEDRLYGDILQWGFLD
T
FFNLTLKEIHFLKWLDIYCPHVPFIFKGDDDVFVNPTNLLEFLADRQPQENLFVGDVLQHARPIRRKDN
K
YYIPGALYGKASYPPYAGGGGFLMAGSLARRLHHACDTLELYPIDDVFLGMCLEVLGVQPTAHEGFKTF
G
ISRNRNSRMNKEPCFFRAMLVVHKLLPPELLAMWGLVHSNLTCSRKLQVL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser