NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS4338.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
4338.1 Public Homo sapiens 5 ADAM19 20 108 85 CCDS HistoryNCBI Gene:8728Re-query CCDS DB by CCDS ID:4338.1Re-query CCDS DB by GeneID:8728See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 4338.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000257527 ENSP00000257527 Accepted alive Link to Ensembl Transcript Viewer:ENST00000257527Link to Ensembl Protein Viewer:ENSP00000257527Re-query CCDS DB by Nucleotide ID:ENST00000257527Re-query CCDS DB by Protein ID:ENSP00000257527
Original member Current member EBI,WTSI OTTHUMT00000252566 OTTHUMP00000160734 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000252566Link to Vega Protein Viewer:OTTHUMP00000160734Re-query CCDS DB by Nucleotide ID:OTTHUMT00000252566Re-query CCDS DB by Protein ID:OTTHUMP00000160734
Original member Current member NCBI NM_033274.4 NP_150377.1 Accepted alive Link to Nucleotide Sequence:NM_033274.4Link to Protein Sequence:NP_150377.1Re-query CCDS DB by Nucleotide ID:NM_033274Re-query CCDS DB by Protein ID:NP_150377Link to BLAST:NP_150377.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_150377.1 918 Q9H013-2 918 100% 0 0

Chromosomal Locations for CCDS 4338.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '-' strand of Chromosome 5 (NC_000005.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 157480949 157481002 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 157481791 157481943 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 157488265 157488489 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 157489102 157489186 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 157490310 157490454 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 157491615 157491723 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 157491835 157491912 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 157492973 157493177 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 157494687 157494795 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 157496894 157497089 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 157499573 157499662 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 157502803 157502980 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 157505669 157505808 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 157507056 157507140 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 157509301 157509467 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 157513434 157513505 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 157518823 157518888 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 157519839 157520031 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 157530807 157530883 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 157537913 157537991 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 157564373 157564443 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 157570895 157570980 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 157575603 157575696 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2757 nt):
ATGCCAGGGGGCGCAGGCGCCGCCCGGCTCTGCTTGCTGGCGTTTGCCCTGCAGCCCCTCCGGCCGCGGG
CG
GCGCGGGAGCCTGGATGGACAAGAGGAAGTGAGGAAGGCAGCCCCAAGCTGCAGCATGAACTTATCAT
A
CCTCAGTGGAAGACTTCAGAAAGCCCCGTGAGAGAAAAGCATCCACTCAAAGCTGAGCTCAGGGTAATG
GCT
GAGGGGCGAGAACTGATCCTGGACCTGGAGAAGAATGAGCAACTTTTTGCTCCTTCCTACACAGAAA
CC
CATTATACTTCAAGTGGTAACCCTCAAACCACCACACGGAAATTGGAGGATCACTGCTTTTACCACGG
C
ACGGTGAGGGAGACAGAACTGTCCAGCGTCACGCTCAGCACTTGCCGAGGAATTAGAGGACTGATTACG
GTG
AGCAGCAACCTCAGCTACGTCATCGAGCCCCTCCCTGACAGCAAGGGCCAACACCTTATTTACAGAT
CT
GAACATCTCAAGCCGCCCCCGGGAAACTGTGGGTTCGAGCACTCCAAGCCCACCACCAGGGACTGGGC
T
CTTCAGTTTACACAACAGACCAAGAAGCGACCTCGCAGGATGAAAAGGGAAGATTTAAACTCCATGAAG
TAT
GTGGAGCTTTACCTCGTGGCTGATTATTTAGAGTTTCAGAAGAATCGACGAGACCAGGACGCCACCA
AA
CACAAGCTCATAGAGATCGCCAACTATGTTGATAAGTTTTACCGATCCTTGAACATCCGGATTGCTCT
C
GTGGGCTTGGAAGTGTGGACCCACGGGAACATGTGTGAAGTTTCAGAGAATCCATATTCTACCCTCTGG
TCC
TTTCTCAGTTGGAGGCGCAAGCTGCTTGCCCAGAAGTACCATGACAACGCCCAATTAATCACGGGCA
TG
TCCTTCCACGGCACCACCATCGGCCTGGCCCCCCTCATGGCCATGTGCTCTGTGTACCAGTCTGGAGG
A
GTCAACATGGACCACTCCGAGAATGCCATTGGCGTGGCTGCCACCATGGCCCACGAGATGGGCCACAAC
TTT
GGCATGACCCATGATTCTGCAGATTGCTGCTCGGCCAGTGCGGCTGATGGTGGGTGCATCATGGCAG
CT
GCCACTGGGCACCCCTTTCCCAAAGTGTTCAATGGATGCAACAGGAGGGAGCTGGACAGGTATCTGCA
G
TCAGGTGGTGGAATGTGTCTCTCCAACATGCCAGACACCAGGATGTTGTATGGAGGCCGGAGGTGTGGG
AAC
GGGTATCTGGAAGATGGGGAAGAGTGTGACTGTGGAGAAGAAGAGGAATGTAACAACCCCTGCTGCA
AT
GCCTCTAATTGTACCCTGAGGCCGGGGGCGGAGTGTGCTCACGGCTCCTGCTGCCACCAGTGTAAGCT
G
TTGGCTCCTGGGACCCTGTGCCGCGAGCAGGCCAGGCAGTGTGACCTCCCGGAGTTCTGTACGGGCAAG
TCT
CCCCACTGCCCTACCAACTTCTACCAGATGGATGGTACCCCCTGTGAGGGCGGCCAGGCCTACTGCT
AC
AACGGCATGTGCCTCACCTACCAGGAGCAGTGCCAGCAGCTGTGGGGACCCGGAGCCCGACCTGCCCC
T
GACCTCTGCTTCGAGAAGGTGAATGTGGCAGGAGACACCTTTGGAAACTGTGGAAAGGACATGAATGGT
GAA
CACAGGAAGTGCAACATGAGAGATGCGAAGTGTGGGAAGATCCAGTGTCAGAGCTCTGAGGCCCGGC
CC
CTGGAGTCCAACGCGGTGCCCATTGACACCACTATCATCATGAATGGGAGGCAGATCCAGTGCCGGGG
C
ACCCACGTCTACCGAGGTCCTGAGGAGGAGGGTGACATGCTGGACCCAGGGCTGGTGATGACTGGAACC
AAG
TGTGGCTACAACCATATTTGCTTTGAGGGGCAGTGCAGGAACACCTCCTTCTTTGAAACTGAAGGCT
GT
GGGAAGAAGTGCAATGGCCATGGGGTCTGTAACAACAACCAGAACTGCCACTGCCTGCCGGGCTGGGC
C
CCGCCCTTCTGCAACACACCGGGCCACGGGGGCAGTATCGACAGTGGGCCTATGCCCCCTGAGAGTGTG
GGT
CCTGTGGTAGCTGGAGTGTTGGTGGCCATCTTGGTGCTGGCGGTCCTCATGCTGATGTACTACTGCT
GC
AGACAGAACAACAAACTAGGCCAACTCAAGCCCTCAGCTCTCCCTTCCAAGCTGAGGCAACAGTTCAG
T
TGTCCCTTCAGGGTTTCTCAGAACAGCGGGACTGGTCATGCCAACCCAACTTTCAAGCTGCAGACGCCC
CAG
GGCAAGCGAAAGGTGATCAACACTCCGGAAATCCTGCGGAAGCCCTCCCAGCCTCCTCCCCGGCCCC
CT
CCAGATTATCTGCGTGGTGGGTCCCCACCTGCACCACTGCCAGCTCACCTGAGCAGGGCTGCTAGGAA
C
TCCCCAGGGCCCGGGTCTCAAATAGAGAGGACGGAGTCGTCCAGGAGGCCTCCTCCAAGCCGGCCAATT
CCC
CCCGCACCAAATTGCATCGTTTCCCAGGACTTCTCCAGGCCTCGGCCGCCCCAGAAGGCACTCCCGG
CA
AACCCAGTGCCAGGCCGCAGGAGCCTCCCCAGGCCAGGAGGTGCATCCCCACTGCGGCCCCCTGGTGC
T
GGCCCTCAGCAGTCCCGGCCTCTGGCAGCACTTGCCCCAAAGTTTCCAGAATACAGATCACAGAGGGCT
GGA
GGGATGATTAGCTCGAAAATCTAG


Translation (918 aa):
MPGGAGAARLCLLAFALQPLRPRAAREPGWTRGSEEGSPKLQHELIIPQWKTSESPVREKHPLKAELRVM
A
EGRELILDLEKN
EQLFAPSYTETHYTSSGNPQTTTRKLEDHCFYHGTVRETELSSVTLSTCRGIRGLIT
V
SSNLSYVIEPLPDSKGQHLIYRSEHLKPPPGNCGFEHSKPTTRDWALQFTQQTKKRPRR
MKREDLNSMK
Y
VELYLVADYLE
FQKNRRDQDATKHKLIEIANYVDKFYRSLNIRIALVGLEVWTHGNMCEVSENPYSTLW
S
FLSWRRKLLAQKYHDNAQLI
TGMSFHGTTIGLAPLMAMCSVYQSGGVNMDHSENAIGVAATMAHEMGHN
F
GMTHDSADCCSASAADGGCIMAAAT
GHPFPKVFNGCNRRELDRYLQSGGGMCLSNMPDTRMLYGGRRCG
N
GYLEDGEECDCGEEE
ECNNPCCNASNCTLRPGAECAHGSCCHQCKLLAPGTLCREQARQCDLPEFCTGK
S
PHCPTNFYQMDGTPCEGGQAYCYNGMCLTYQEQCQQLWGP
GARPAPDLCFEKVNVAGDTFGNCGKDMNG
E
HRKCNM
RDAKCGKIQCQSSEARPLESNAVPIDTTIIMNGRQIQCRGTHVYRGPEEEGDMLDPGLVMTGT
K
CGYNH
ICFEGQCRNTSFFETEGCGKKCNGHGVCNNNQNCHCLPGWAPPFCNTPGHGGSIDSGPMPPESV
G
PVVAGVLVAILVLAVLMLMYYCCRQNNKLGQLKPSALPSKLRQQF
SCPFRVSQNSGTGHANPTFKLQTP
Q
GKRK
VINTPEILRKPSQPPPRPPPDYLRGGSPPAPLPAHLSRAARNSPGPGSQIERTESSRRPPPSRPI
P
PAPNCIVSQ
DFSRPRPPQKALPANPVPGRRSLPRPGGASPLRPPGAGPQQSRPLAALAPKFPEYRSQRA
G
GMISSKI




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser