NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS44072.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
44072.1 Public Homo sapiens 1 ATP13A2 20 108 85 CCDS HistoryNCBI Gene:23400Re-query CCDS DB by CCDS ID:44072.1Re-query CCDS DB by GeneID:23400See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 6, NCBI annotation release 37.1, Ensembl annotation release 55

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 44072.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000341676 ENSP00000341115 Accepted alive Link to Ensembl Transcript Viewer:ENST00000341676Link to Ensembl Protein Viewer:ENSP00000341115Re-query CCDS DB by Nucleotide ID:ENST00000341676Re-query CCDS DB by Protein ID:ENSP00000341115
Original member Current member EBI,WTSI OTTHUMT00000006618 OTTHUMP00000002400 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000006618Link to Vega Protein Viewer:OTTHUMP00000002400Re-query CCDS DB by Nucleotide ID:OTTHUMT00000006618Re-query CCDS DB by Protein ID:OTTHUMP00000002400
Original member Current member NCBI NM_001141974.2 NP_001135446.1 Accepted alive Link to Nucleotide Sequence:NM_001141974.2Link to Protein Sequence:NP_001135446.1Re-query CCDS DB by Nucleotide ID:NM_001141974Re-query CCDS DB by Protein ID:NP_001135446Link to BLink:NP_001135446.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001135446.1 1158 Q9NQ11-2 1158 100% 0 0

Chromosomal Locations for CCDS 44072.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '-' strand of Chromosome 1 (NC_000001.11)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 1Link to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 16985985 16986358 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 16986805 16986956 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 16987046 16987269 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 16988138 16988234 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 16988322 16988474 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 16989691 16989770 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 16990127 16990287 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 16991734 16991858 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 16992009 16992129 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 16992243 16992402 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 16992486 16992581 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 16993629 16993835 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 16995976 16996164 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 16996254 16996300 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 16996386 16996496 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 16997020 16997175 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 17000011 17000142 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 17000246 17000312 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 17000400 17000534 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 17002034 17002103 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 17002296 17002373 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 17004332 17004411 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 17004707 17004821 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 17005014 17005072 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 17005374 17005556 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 17005684 17005778 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 17011729 17011738 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3477 nt):
ATGAGCGCAGACAGCAGCCCTCTCGTGGGCAGCACGCCCACCGGTTATGGGACCCTGACGATAGGGACAT
CA
ATAGATCCCCTCAGCTCCTCAGTTTCATCCGTGAGGCTCAGCGGCTACTGTGGCAGTCCATGGAGGGT
C
ATCGGCTATCACGTCGTGGTCTGGATGATGGCTGGGATCCCTTTGCTGCTCTTCCGTTGGAAGCCCCTG
TGG
GGGGTGCGGCTGCGGCTCCGGCCCTGCAACCTGGCCCACGCCGAAACACTCGTTATCGAAATAAGAG
AC
AAAGAGGATAGTTCCTGGCAGCTCTTCACTGTCCAGGTGCAGACTGAGGCCATCGGCGAGGGCAGCCT
G
GAGCCGTCCCCACAGTCCCAGGCAGAGGATGGCCGGAGCCAGGCGGCAGTTGGGGCGGTACCAGAGGGT
GCC
TGGAAGGATACGGCCCAGCTCCACAAGAGCGAGGAGGCGAAGCGGGTGCTGCGGTATTACCTCTTCC
AG
GGCCAGCGCTATATCTGGATCGAGACCCAGCAAGCCTTCTACCAGGTCAGCCTCCTGGACCATGGCCG
C
TCTTGTGACGACGTCCACCGCTCCCGCCATGGCCTCAGCCTCCAGGACCAAATGGTGAGGAAGGCCATT
TAC
GGCCCCAACGTGATCAGCATACCGGTCAAGTCCTACCCCCAGCTGCTGGTGGACGAGGCACTGAACC
CC
TACTATGGGTTCCAGGCCTTCAGCATCGCGCTGTGGCTGGCTGACCACTACTACTGGTACGCCCTGTG
C
ATCTTCCTCATTTCCTCCATCTCCATCTGCCTGTCGCTGTACAAGACCAGAAAGCAAAGCCAGACTCTA
AGG
GACATGGTCAAGTTGTCCATGCGGGTGTGCGTGTGCCGGCCAGGGGGAGAGGAAGAGTGGGTGGACT
CC
AGTGAGCTAGTGCCCGGAGACTGCCTGGTGCTGCCCCAGGAGGGTGGGCTGATGCCCTGTGATGCCGC
C
CTGGTGGCCGGCGAGTGCATGGTGAATGAGAGCTCTCTGACAGGAGAGAGCATTCCAGTGCTGAAGACG
GCA
CTGCCGGAGGGGCTGGGGCCCTACTGTGCAGAGACACACCGGCGGCACACACTCTTCTGCGGGACCC
TC
ATCTTGCAGGCCCGGGCCTATGTGGGACCGCACGTCCTGGCAGTGGTGACCCGCACAGGGTTCTGCAC
G
GCAAAAGGGGGCCTGGTGAGCTCCATCTTGCACCCCCGGCCCATCAACTTCAAGTTCTATAAACACAGC
ATG
AAGTTTGTGGCTGCCCTCTCTGTCCTGGCTCTCCTCGGCACCATCTACAGCATCTTCATCCTCTACC
GA
AACCGGGTGCCTCTGAATGAGATTGTAATCCGGGCTCTCGACCTGGTGACCGTGGTGGTGCCACCTGC
C
CTGCCTGCTGCCATGACTGTGTGCACGCTCTACGCCCAGAGCCGACTGCGGAGACAGGGCATTTTCTGC
ATC
CACCCACTGCGCATCAACCTGGGGGGCAAGCTGCAGCTGGTGTGTTTCGACAAGACGGGCACCCTCA
CT
GAGGACGGCTTAGACGTGATGGGGGTGGTGCCCCTGAAGGGGCAGGCATTCCTGCCCCTGGTCCCAGA
G
CCTCGCCGCCTGCCTGTGGGGCCCCTGCTCCGAGCACTGGCCACCTGCCATGCCCTCAGCCGGCTCCAG
GAC
ACCCCCGTGGGCGACCCCATGGACTTGAAGATGGTGGAGTCTACTGGCTGGGTCCTGGAGGAAGAGC
CG
GCTGCAGACTCAGCATTTGGGACCCAGGTCTTGGCAGTGATGAGACCCCCACTTTGGGAGCCCCAGCT
G
CAGGCAATGGAGGAGCCCCCGGTGCCAGTCAGCGTCCTCCACCGCTTCCCCTTCTCTTCGGCTCTGCAG
CGC
ATGAGTGTGGTGGTGGCGTGGCCAGGGGCCACTCAGCCCGAGGCCTACGTCAAAGGCTCCCCGGAGC
TG
GTGGCAGGGCTCTGCAACCCCGAGACAGTGCCCACCGACTTCGCCCAGATGCTGCAGAGCTATACAGC
T
GCTGGCTACCGTGTCGTGGCCCTGGCCAGCAAGCCACTGCCCACTGTGCCCAGCCTGGAGGCAGCCCAG
CAA
CTGACGAGGGACACTGTGGAAGGAGACCTGAGCCTCCTGGGGCTGCTGGTCATGAGGAACCTACTGA
AG
CCGCAGACAACGCCAGTTATCCAGGCTCTGCGAAGGACCCGCATCCGCGCCGTCATGGTGACAGGGGA
C
AACCTGCAGACAGCGGTGACTGTGGCCCGGGGCTGTGGCATGGTGGCCCCCCAGGAGCATCTGATCATC
GTC
CACGCCACCCACCCTGAGCGGGGTCAGCCTGCCTCTCTCGAGTTCCTGCCGATGGAGTCCCCCACAG
CC
GTGAATGGCGTTAAGGTCCTGGTCCAGGGCACTGTCTTTGCCCGCATGGCCCCTGAGCAGAAGACAGA
G
CTGGTGTGCGAGCTACAGAAGCTTCAGTACTGCGTGGGCATGTGCGGAGACGGCGCCAATGACTGTGGG
GCC
CTGAAGGCGGCTGATGTCGGCATCTCGCTGTCCCAGGCAGAAGCCTCAGTGGTCTCACCCTTCACCT
CG
AGCATGGCCAGTATTGAGTGCGTGCCCATGGTCATCAGGGAGGGGCGCTGTTCCCTTGACACTTCGTT
C
AGCGTCTTCAAGTACATGGCTCTGTACAGCCTGACCCAGTTCATCTCCGTCCTGATCCTCTACACGATC
AAC
ACCAACCTGGGTGACCTGCAGTTCCTGGCCATCGACCTGGTCATCACCACCACAGTGGCAGTGCTCA
TG
AGCCGCACGGGGCCAGCGCTGGTCCTGGGACGGGTGCGGCCACCGGGGGCGCTGCTCAGCGTGCCCGT
G
CTCAGCAGCCTGCTGCTGCAGATGGTCCTGGTGACCGGCGTGCAGCTAGGGGGCTACTTCCTGACCCTG
GCC
CAGCCATGGTTCGTGCCTCTGAACAGGACAGTGGCCGCACCAGACAACCTGCCCAACTACGAGAACA
CC
GTGGTCTTCTCTCTGTCCAGCTTCCAGTACCTCATCCTGGCTGCAGCCGTGTCCAAGGGGGCGCCCTT
C
CGCCGGCCGCTCTACACCAATGAGCGTGCTAGACCAGTGCCTCCCCGCCTGCCTGCGCCGCCTCCGGCC
CAA
GCGGGCCTCCAAGAAGCGCTTCAAGCAGCTGGAACGAGAGCTGGCCGAGCAGCCCTGGCCGCCGCTG
CC
CGCCGGCCCCCTGAGGTAGTGCAGGCCCACGGGCACCCCAGACACTGGAACTCCCTGCCTCTGAGCCA
C
CAACTGGACCCCTCTCCAGCAACACCACCGCCACCACCTCCCACATCCCTGAGGTTGGCGACTGTCTAC
ACT
CCTCCCCCGAGACCACCCCCACCCTGGGGAAGCGTTGACTACTGTCCCCTACCTTGGACCATCCCGC
GT
AGGGGTGGCAGCCCCCAGCTCCCCTCAGTGCTGCTGTCAGTGTAG


Translation (1158 aa):
MSADSSPLVGSTPTGYGTLTIGTSIDPLSSSVSSVRLSGYCGSPWRVIGYHVVVWMMAGIPLLLFRWKPL
W
GVRLRLRPCNLAHAETLVIEIRDKE
DSSWQLFTVQVQTEAIGEGSLEPSPQSQAEDGRSQAAVGAVPEG
A
WKDTAQLHKSEEA
KRVLRYYLFQGQRYIWIETQQAFYQVSLLDHGRSCDDVHRSRHGLSLQDQMVRKAI
Y
GPNVISIPVKSYPQLLVDE
ALNPYYGFQAFSIALWLADHYYWYALCIFLISSISICLSLYKTRKQSQTL
R
DMVKLSMRVCVCRPGG
EEEWVDSSELVPGDCLVLPQEGGLMPCDAALVAGECMVNESSLTGESIPVLKT
A
LPEGLGPYCAETHRRHTLFCGTLILQARAYVGPHVLAVVTRT
GFCTAKGGLVSSILHPRPINFKFYKHS
M
KFVAALSVL
ALLGTIYSIFILYRNRVPLNEIVIRALDLVTVVVPPALPAAMTVCTLYAQSRLRRQGIFC
I
HPLRINLGGKLQLVCFDK
TGTLTEDGLDVMGVVPLKGQAFLPLVPEPRRLPVGPLLRALATCHALSRLQ
D
TPVGDPMDLKMVESTGW
VLEEEPAADSAFGTQVLAVMRPPLWEPQLQAMEEPPVPVSVLHRFPFSSALQ
R
MSVVVAWPGATQPEAYVKGSPELVAGLCNPET
VPTDFAQMLQSYTAAGYRVVALASKPLPTVPSLEAAQ
Q
LT
RDTVEGDLSLLGLLVMRNLLKPQTTPVIQALRRTRIRAVMVTGDNLQTAVTVARGCGMVAPQEHLII
V
HATHPERGQPASLEFLPMESPTAVNGVK
VLVQGTVFARMAPEQKTELVCELQKLQYCVGMCGDGANDCG
A
LKAADVGISLSQAEASVVSPFTSSMASIECVPMVI
REGRCSLDTSFSVFKYMALYSLTQFISVLILYTI
N
TNLGDLQFLAIDLVITTTVAVLMSRTGPALVLGRVRPPGALLSVPVLSSLLLQMVLVTGVQLGGYFLTL
A
QP
WFVPLNRTVAAPDNLPNYENTVVFSLSSFQYLILAAAVSKGAPFRRPLYTNERARPVPPRLPAPPPA
Q
AGLQEALQAAGTRAGRAALAAAARRPPEVVQAHGHPRHWNSLPLSHQLDPSPATPPPPPPTSLRLATVY
T
PPPRPPPPWGSVDYCPLPWTIPRRGGSPQLPSVLLSV




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser