NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS85405.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
85405.1 Public Mus musculus 7 Arhgap17 21 106 86 CCDS HistoryNCBI Gene:70497Re-query CCDS DB by CCDS ID:85405.1Re-query CCDS DB by GeneID:70497See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 21, NCBI annotation release 106, Ensembl annotation release 86

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 85405.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000207010 ENSMUSP00000145628 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000207010Link to Ensembl Protein Viewer:ENSMUSP00000145628Re-query CCDS DB by Nucleotide ID:ENSMUST00000207010Re-query CCDS DB by Protein ID:ENSMUSP00000145628
Original member Current member EBI,WTSI OTTMUST00000142741 OTTMUSP00000074442 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000142741Link to Vega Protein Viewer:OTTMUSP00000074442Re-query CCDS DB by Nucleotide ID:OTTMUST00000142741Re-query CCDS DB by Protein ID:OTTMUSP00000074442
Original member Current member NCBI NM_001122642.1 NP_001116114.1 Accepted alive Link to Nucleotide Sequence:NM_001122642.1Link to Protein Sequence:NP_001116114.1Re-query CCDS DB by Nucleotide ID:NM_001122642Re-query CCDS DB by Protein ID:NP_001116114Link to BLAST:NP_001116114.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001116114.1 740 Q3UIA2-3 740 100% 0 0

Chromosomal Locations for CCDS 85405.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 123285421 123285467 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 123286498 123287013 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 123292036 123292205 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 123296410 123296566 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 123297495 123297586 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 123300489 123300602 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 123303696 123303776 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 123306375 123306456 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 123306968 123307079 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 123308286 123308413 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 123314414 123314495 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 123314644 123314712 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 123318387 123318498 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 123321588 123321664 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 123321879 123321990 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 123323613 123323686 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 123327239 123327343 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 123331226 123331265 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 123369754 123369806 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2223 nt):
ATGAAGAAGCAATTCAACCGCATGAAGCAGCTGGCCAATCAGACTGTCGGCAGAGCTGAGAAGACCGAAG
TC
CTCAGTGAAGATCTGCTACAGATTGAACGTCGCCTGGACACTGTGCGTTCAATGTGCCACCATTCACA
T
AAGCGTTTGATAGCCTGCTTCCAAGGTCAGCATGGCACTGATGCCGAGAGGAGACATAAAAAGCTTCCT
CTG
ACAGCTCTTGCCCAGAACATGCAGGAGGCTTCAGCCCAGCTGGAAGAGTCTCTCTTGGGGAAGATGC
TG
GAGACCTGTGGGGACGCTGAGAACCAGCTGGCTCTTGAACTCTCACAACATGAAGTCTTTGTGGAGAA
G
GAGATCATGGACCCTCTCTACGGCATAGCAGAGGTGGAGATTCCCAATATCCAGAAGCAAAGGAAGCAG
CTT
GCTAGATTGGTGTTGGACTGGGATTCAGTCAGAGCGAGATGGAACCAAGCACACAAGTCTTCAGGAA
CC
AACTTTCAGGGGCTTCCATCCAAAATAGATACCCTAAAGGAAGAGATGGATGAAGCTGGGAATAAAGT
T
GAACAGTGCAAGGATCAACTTGCAGCAGACATGTACAACTTCATGGCCAAAGAAGGGGAGTATGGCAAG
TTC
TTCGTGACGTTATTAGAAGCCCAAGCAGATTACCATAGAAAAGCATTAGCAGTCTTAGAAAAGGCCC
TT
CCCGAAATGCGCGCCCATCAAGATAAGTGGGCAGAGAAGCCAGCCTTCGGCACACCTCTGGAGGAACA
C
CTGAAGAGGAGTGGGCGTGAGATCGCCCTGCCTATTGAGGCCTGTGTCATGTTGTTGCTGGAGACTGGC
ATG
AAAGAGGAGGGCCTTTTTCGGATTGGAGCTGGAGCCTCCAAGTTGAAGAAGCTGAAAGCTGCTCTCG
AC
TGCTCCACATCGCATCTGGATGAATTCTATTCTGATCCCCATGCTGTCGCAGGTGCTTTAAAGTCCTA
T
CTGCGGGAGTTGCCTGAGCCCTTAATGACTTTCAGTCTGTATGAAGAATGGACACAAGTTGCAAGTGTG
CAG
GATCAAGACAAAAAACTTCAATATTTATGGACAACATGTCAGAAGTTGCCGCCACAAAATTTTGTTA
AC
TTTAGGTATTTAATCAAGTTCCTTGCAAAGCTTGCCCAGACCAGTGACGTTAATAAAATGACTCCTAG
C
AACATAGCCATTGTCCTGGGCCCTAACCTCCTGTGGGCCAAACAAGAAGGAACGCTGGCTGAAATAGCG
GCT
GCCACATCGGTCCACGTGGTTGCAGTGATTGAGCCCATCATCCAGCATGCAGATTGGTTCTTCCCTG
GA
GAGGTAGAATTCAATGTATCAGAAGCATTTGTGCCACTTGCTACCCCGAATTCTAATCACTCATCCCA
T
ACTGGAAATGACTCTGACTCGGGGACTCTGGAGAGGAAGCGACCTGCCAGCATGGCAGTGATGGAAGGG
GAC
TTGGTGAAGAAGGAGAGTCCTCCAAAACCCAAAGACTCCGTGTCTGCAGCTGTCCCTGCAGCAGGAA
GG
AACAGCAACCAGATGACCACGGTCCCAAACCAGGCTCAGACAGGTGGCAACTCCCATCAGCTCTCAGT
A
AGCACACCTCACAGTGCAGCCGGTCCCAGCCCGCACACTCTGCGTCGGGCTGTGAAGAAACCTGCCCCC
GCA
CCCCCCAAACCAGGAAACCTACCTCCTGGCCACCCTGGAGGACAGAGCTCTCCTGGCACAGGCACAT
CC
CCAAAGCCAAGCGCCCGAAGCCCATCACCGCCTCAGCAGCAGCAGCAGCAGCAACAACAGCAGCAACA
A
CAGCAGCAGCAGCAGACCCCAGGCATGCGCCGCTGCTCCAGCAGCCTGCCTCCCATCCAGGCACCCAGC
CAC
CCACCACCACAGCCCCCCACACAGCCTCGGTTGGGTGAACAGGGACCAGAGCCAGGCCCCACGCCAC
CT
CAAACCCCCACACCACCTAGCACCCCACCCCTGGCCAAGCAGAATCCATCGCAAAGTGAGACCACACA
G
CTGCACGGAACCCTCCCAAGACCACGGCCAGTGCCCAAGCCCCGCAACCGGCCTAGCGTGCCACCACCC
CCA
CATCCACCTGGCACCCACACGGTGGATGGTGGCCTTACATCCTCAGTGCCCACAGCCTCCAGAATCG
TC
ACTGATGCCCTTCCCGGTGCCCTCACAGGTGGGGAAGGTTTCCAGAACTAA


Translation (740 aa):
MKKQFNRMKQLANQTVGRAEKTEVLSEDLLQIERRLDTVRSMCHHSHKRLIACFQGQHGTDAERRHKKLP
L
TALAQNMQEASAQLEESLL
GKMLETCGDAENQLALELSQHEVFVEKEIMDPLYGIAEVEIPNIQKQRKQ
L
ARLVLDWDSVRA
RWNQAHKSSGTNFQGLPSKIDTLKEEMDEAGNKVEQCKDQLAADMYNFMAKEGEYGK
F
FVT
LLEAQADYHRKALAVLEKALPEMRAHQDKWAEKPAFGTPLEEHLKRSGREIALPIEACVMLLLETG
M
KEE
GLFRIGAGASKLKKLKAALDCSTSHLDEFYSDPHAVAGALKSYLRELPEPLMTFSLYEEWTQVASV
Q
DQDKKLQYLWTTCQKLPPQNFVNF
RYLIKFLAKLAQTSDVNKMTPSNIAIVLGPNLLWAKQEGTLAEIA
A
ATSVHVVAVIEPIIQHADWFFPG
EVEFNVSEAFVPLATPNSNHSSHTGNDSDSGTLERKRPASMAVMEG
D
LVKKE
SPPKPKDSVSAAVPAAGRNSNQMTTVPNQAQTGGNSHQLSVSTPHSAAGPSPHTLRRAVKKPAP
A
PPKPGNLPPGHPGGQSSPGTGTSPKPSARSPSPPQQQQQQQQQQQQQQQQQTPGMRRCSSSLPPIQAPS
H
PPPQPPTQPRLGEQGPEPGPTPPQTPTPPSTPPLAKQNPSQSETTQLHGTLPRPRPVPKPRNRPSVPPP
P
HPPGTHTVDGGLTSSVPTASRIVT
DALPGALTGGEGFQN



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser