NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Wednesday, October 16, 2019, starting at 8:00 a.m. EDT for approximately 30 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS85176.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
85176.1 Public Mus musculus 6 Ptpro 21 106 86 CCDS HistoryNCBI Gene:19277Re-query CCDS DB by CCDS ID:85176.1Re-query CCDS DB by GeneID:19277See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 21, NCBI annotation release 106, Ensembl annotation release 86

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 85176.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000203914 ENSMUSP00000144870 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000203914Link to Ensembl Protein Viewer:ENSMUSP00000144870Re-query CCDS DB by Nucleotide ID:ENSMUST00000203914Re-query CCDS DB by Protein ID:ENSMUSP00000144870
Original member Current member EBI,WTSI OTTMUST00000141496 OTTMUSP00000073943 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000141496Link to Vega Protein Viewer:OTTMUSP00000073943Re-query CCDS DB by Nucleotide ID:OTTMUST00000141496Re-query CCDS DB by Protein ID:OTTMUSP00000073943
Original member Current member NCBI NM_001164403.1 NP_001157875.1 Accepted alive Link to Nucleotide Sequence:NM_001164403.1Link to Protein Sequence:NP_001157875.1Re-query CCDS DB by Nucleotide ID:NM_001164403Re-query CCDS DB by Protein ID:NP_001157875Link to BLAST:NP_001157875.1

Chromosomal Locations for CCDS 85176.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 6 (NC_000072.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 137414347 137414350 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 137416803 137416923 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 137418209 137418277 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 137426765 137426800 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 137430672 137430753 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 137441053 137441143 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 137442645 137442721 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 137443518 137443652 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 137443895 137444017 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 137449871 137450025 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 137454585 137454720 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 137461653 137461757 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1134 nt):
ATGGTTACAGAGGTGAACCCTAACGTGGTGGTGATCTCGGTGCTGGCCATCCTCAGCACACTTTTAATTG
GA
CTGCTCTTAGTGACCCTTGTCATTCTCCGAAAGAAGCACCTGCAGATGGCTAGGGAATGTGGAGCTGG
C
ACGTTTGTTAACTTTGCATCCTTAGAAAGGGAAGGGAAACTCCCCTACAGTTGGAGTAAAAATGGCTTA
AAG
AAGAGGAAACTAACAAACCCCGTTCAGCTGGATGACTTCGATTCTTACATCAAGGATATGGCCAAGG
AC
TCGGACTATAAATTCTCTCTTCAGTTTGAGGAGTTGAAGTTGATTGGACTGGATATTCCGCACTTTGC
T
GCAGATCTACCGCTGAACCGATGTAAAAACCGCTACACAAACATCCTGCCGTATGACTTTAGCCGGGTG
AGG
CTAGTCTCCATGAACGAAGAGGAAGGAGCAGACTACATTAATGCCAACTATATTCCTGGATACAACT
CA
CCCCAGGAGTACATTGCCACCCAGGGTCCCCTGCCAGAAACCAGAAATGACTTCTGGAAGATGGTCCT
A
CAACAGAAGTCCCACATCATCGTCATGCTCACTCAATGCAATGAGAAAAGGAGGGTAAAATGTGACCAC
TAC
TGGCCATTCACAGAAGAACCCATTGCTTATGGGGACATCACCGTGGAGATGGTCTCTGAGGAAGAGG
AG
GAGGACTGGGCCAGTAGACACTTCCGGATCAACTATGCGGACGAAGCGCAGGACGTGATGCATTTTAA
C
TACACAGCCTGGCCCGATCACGGCGTGCCTCCAGCAAACGCCGCCGAGAGCATCCTGCAGTTTGTGTTC
ACA
GTGCGACAGCAAGCCGCCAAGAGCAAAGGGCCCATGATCATCCACTGCAGTGCGGGTGTGGGACGGA
CA
GGAACCTTCATTGCCCTGGACAGGCTCCTGCAACACATTCGAGATCATGAATTTGTGGACATCTTAGG
G
CTGGTATCAGAGATGCGCTCATACCGAATGTCAATGGTACAGACAGAGGAGCAGTACATTTTTATCCAT
CAG
TGTGTGCAGCTGATGTGGCTGAGGAAGAAGCAACAGTTCTGCATCAGCGACGTCATCTACGAGAACG
TC
AGCAAATCCTAG


Translation (377 aa):
MVTEVNPNVVVISVLAILSTLLIGLLLVTLVILRKKHLQMARECGAGTFVNFASLEREGKLPYSWSKNGL
K
KRKLT
NPVQLDDFDSYIKDMAKDSDYKFSLQFEELKLIGLDIPHFAADLPLNRCKNRYTNILPYDFSRV
R
LVSMNEEEGADYINANYIP
GYNSPQEYIATQGPLPETRNDFWKMVLQQKSHIIVMLTQCNEKRRVKCDH
Y
WPFTEEPIAYGDITVEMVSEEEEEDWASRHFRINY
ADEAQDVMHFNYTAWPDHGVPPANAAESILQFVF
T
VRQQAAKSKGPMIIHC
SAGVGRTGTFIALDRLLQHIRDHEFVDILGLVSEMRSYRMSMVQTEEQYIFIH
Q
CVQLMWLRKKQQFCISDVIYENVSKS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser