NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS83973.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
83973.1 Public Mus musculus 12 Erh 21 106 86 CCDS HistoryNCBI Gene:13877Re-query CCDS DB by CCDS ID:83973.1Re-query CCDS DB by GeneID:13877See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 21, NCBI annotation release 106, Ensembl annotation release 86

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 83973.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000166931 ENSMUSP00000129620 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000166931Link to Ensembl Protein Viewer:ENSMUSP00000129620Re-query CCDS DB by Nucleotide ID:ENSMUST00000166931Re-query CCDS DB by Protein ID:ENSMUSP00000129620
Original member Current member EBI,WTSI OTTMUST00000091729 OTTMUSP00000050550 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000091729Link to Vega Protein Viewer:OTTMUSP00000050550Re-query CCDS DB by Nucleotide ID:OTTMUST00000091729Re-query CCDS DB by Protein ID:OTTMUSP00000050550
Current member NCBI NM_001347409.1 NP_001334338.1 Accepted alive Link to Nucleotide Sequence:NM_001347409.1Link to Protein Sequence:NP_001334338.1Re-query CCDS DB by Nucleotide ID:NM_001347409Re-query CCDS DB by Protein ID:NP_001334338Link to BLAST:NP_001334338.1

Chromosomal Locations for CCDS 83973.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 12 (NC_000078.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 80634425 80634527 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 80637490 80637610 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 80640957 80641044 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 80642789 80642845 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 80643764 80643766 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (372 nt):
ATGTGCCTGCGACAGACAGAAGAGGGCGTCCGATCCCCAGGATTGGAATTACCTGTGATGTCTCACACCA
TT
TTGCTGGTACAGCCTACCAAGAGGCCAGAGGGCAGGACTTATGCTGACTATGAGTCTGTGAATGAGTG
C
ATGGAAGGTGTTTGTAAAATGTATGAAGAACATCTGAAGAGGATGAATCCCAACAGCCCTTCCATCACA
TAC
GATATCAGCCAGTTGTTTGATTTTATTGACGATCTGGCAGACCTCAGCTGTCTGGTTTACCGAGCTG
AT
ACACAGACATACCAGCCGTATAACAAAGACTGGATCAAAGAGAAGATCTACGTGCTCCTCCGTCGGCA
G
GCCCAACAGGCTGGGAAGTAA


Translation (123 aa):
MCLRQTEEGVRSPGLELPVMSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSIT
Y
DISQLFDFIDDLADLSCL
VYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser