NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS80970.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
80970.1 Public Mus musculus 9 B3gat1 21 106 86 CCDS HistoryNCBI Gene:76898Re-query CCDS DB by CCDS ID:80970.1Re-query CCDS DB by GeneID:76898See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 19, NCBI annotation release 105, Ensembl annotation release 81

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 80970.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000115269 ENSMUSP00000110924 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000115269Link to Ensembl Protein Viewer:ENSMUSP00000110924Re-query CCDS DB by Nucleotide ID:ENSMUST00000115269Re-query CCDS DB by Protein ID:ENSMUSP00000110924
Original member Current member EBI,WTSI ENSMUST00000160899 ENSMUSP00000124067 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000160899Link to Ensembl Protein Viewer:ENSMUSP00000124067Re-query CCDS DB by Nucleotide ID:ENSMUST00000160899Re-query CCDS DB by Protein ID:ENSMUSP00000124067
Original member Current member EBI,WTSI ENSMUST00000159799 ENSMUSP00000124438 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000159799Link to Ensembl Protein Viewer:ENSMUSP00000124438Re-query CCDS DB by Nucleotide ID:ENSMUST00000159799Re-query CCDS DB by Protein ID:ENSMUSP00000124438
Original member Current member EBI,WTSI OTTMUST00000070931 OTTMUSP00000036221 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000070931Link to Vega Protein Viewer:OTTMUSP00000036221Re-query CCDS DB by Nucleotide ID:OTTMUST00000070931Re-query CCDS DB by Protein ID:OTTMUSP00000036221
Original member Current member EBI,WTSI OTTMUST00000070932 OTTMUSP00000036222 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000070932Link to Vega Protein Viewer:OTTMUSP00000036222Re-query CCDS DB by Nucleotide ID:OTTMUST00000070932Re-query CCDS DB by Protein ID:OTTMUSP00000036222
Original member Current member EBI,WTSI OTTMUST00000071065 OTTMUSP00000036329 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000071065Link to Vega Protein Viewer:OTTMUSP00000036329Re-query CCDS DB by Nucleotide ID:OTTMUST00000071065Re-query CCDS DB by Protein ID:OTTMUSP00000036329
Original member Current member NCBI NM_001310766.1 NP_001297695.1 Accepted alive Link to Nucleotide Sequence:NM_001310766.1Link to Protein Sequence:NP_001297695.1Re-query CCDS DB by Nucleotide ID:NM_001310766Re-query CCDS DB by Protein ID:NP_001297695Link to BLAST:NP_001297695.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001297695.1 347 Q9CW73-2 347 100% 0 0

Chromosomal Locations for CCDS 80970.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 26751596 26751599 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 26751744 26751890 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 26755586 26756094 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 26756737 26757033 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 26757693 26757779 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1044 nt):
ATGGGTAATGAGGAGCTGTGGGTGCAGCCAGCCTTGGAGATGCCGAAGAGACGGGACATCCTTGCGATTG
TC
CTCATCGTGCTTCCCTGGACACTGCTCATCACCGTCTGGCACCAGAGCAGCCTCGCACCTCTGCTTGC
T
GTGCACAAGGATGAGGGAAGTGACCCCCGCCATGAGGCACCACCTGGTGCGGACCCTAGGGAGTACTGC
ATG
TCCGACCGTGACATCGTGGAAGTGGTGCGCACAGAGTACGTGTACACGAGGCCGCCACCCTGGTCCG
AC
ACGCTGCCCACCATCCATGTGGTGACGCCCACCTACAGTAGACCGGTGCAGAAGGCAGAGCTGACGCG
A
ATGGCCAACACACTACTGCATGTGCCCAACCTTCACTGGCTAGTGGTGGAGGATGCTCCACGCAGGACG
CCC
CTCACCGCGCGCTTGCTGCGCGACACTGGCCTCAACTACACACACCTGCACGTAGAGACACCACGCA
AC
TATAAGCTGCGAGGTGATGCCCGAGACCCTCGCATCCCACGTGGCACCATGCAGCGCAACCTGGCACT
G
CGCTGGCTGCGGGAGACCTTCCCACGGAACTCTACTCAGCCAGGCGTAGTGTACTTCGCGGATGATGAC
AAC
ACGTACAGTCTGGAGCTCTTTGAAGAGATGCGCAGCACAAGAAGGGTGTCCGTGTGGCCTGTGGCCT
TT
GTTGGTGGCCTTCGGTATGAGGCCCCACGGGTGAATGGGGCAGGGAAAGTGGTTGGCTGGAAGACAGT
C
TTCGACCCCCACCGGCCCTTTGCAATAGACATGGCTGGATTTGCTGTCAACCTCCGGCTCATCTTGCAG
CGA
AGTCAAGCCTACTTTAAGCTACGTGGTGTGAAGGGAGGCTACCAGGAAAGCAGTCTCCTTCGAGAAC
TT
GTCACCCTCAATGACCTGGAGCCCAAGGCAGCAAACTGTACCAAGATCTTGGTCTGGCATACACGAAC
A
GAGAAGCCAGTGCTGGTCAATGAGGGGAAGAAGGGCTTCACCGACCCCTCAGTGGAGATCTGA


Translation (347 aa):
MGNEELWVQPALEMPKRRDILAIVLIVLPWTLLITVWHQSSLAPLLAVHKDEGSDPRHEAPPGADPREYC
M
SDRDIVEVVRTEYVYTRPPPWSDTLPTIHVVTPTYSRPVQKAELTRMANTLLHVPNLHWLVVEDAPRRT
P
LTARLLRDTGLNYTHLHVETPRNYKLRGDARDPRIPRGTMQRNLALRWLRETFPRNSTQPGVVYFADDD
N
TYSLELFEE
MRSTRRVSVWPVAFVGGLRYEAPRVNGAGKVVGWKTVFDPHRPFAIDMAGFAVNLRLILQ
R
SQAYFKLRGVKGGYQESSLLRELVTLNDLEPKAANCTK
ILVWHTRTEKPVLVNEGKKGFTDPSVEI



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser