NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS80619.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
80619.1 Public Mus musculus 6 Olr1 23 108 98 CCDS HistoryNCBI Gene:108078Re-query CCDS DB by CCDS ID:80619.1Re-query CCDS DB by GeneID:108078See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 19, NCBI annotation release 105, Ensembl annotation release 81

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 80619.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000183258.7 ENSMUSP00000138228.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000183258.7Link to Ensembl Protein Viewer:ENSMUSP00000138228.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000183258Re-query CCDS DB by Protein ID:ENSMUSP00000138228
Original member Current member NCBI NM_001301096.1 NP_001288025.1 Accepted alive Link to Nucleotide Sequence:NM_001301096.1Link to Protein Sequence:NP_001288025.1Re-query CCDS DB by Nucleotide ID:NM_001301096Re-query CCDS DB by Protein ID:NP_001288025Link to BLAST:NP_001288025.1

Chromosomal Locations for CCDS 80619.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 6 (NC_000072.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 129487666 129487807 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 129488084 129488199 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 129488832 129488968 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 129507035 129507107 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (468 nt):
ATGACTTTTGATGACAAGATGAAGCCTGCGAATGACGAGCCTGATCAGAAGTCATGTGGCAAGAAGCCTA
AA
GGTCCTTGTCCACAAGACTGGCTCTGGCATAAAGAAAACTGTTACCTCTTCCATGGGCCCTTTAGCTG
G
GAAAAAAACCGGCAGACCTGCCAATCTTTGGGTGGCCAGTTACTACAAATTAATGGTGCAGATGATCTG
ACA
TTCATCTTACAAGCAATTTCCCATACCACCTCCCCGTTCTGGATTGGATTGCATCGGAAGAAGCCTG
GC
CAACCATGGCTATGGGAGAATGGAACTCCTTTGAATTTTCAATTCTTTAAGACCAGGGGCGTTTCTTT
A
CAGCTATATTCATCAGGCAACTGTGCATACCTTCAAGACGGAGCTGTGTTCGCTGAAAACTGCATTCTA
ATT
GCATTCAGCATATGTCAGAAGAAGACAAATCATTTGCAAATTTAG


Translation (155 aa):
MTFDDKMKPANDEPDQKSCGKKPKGPCPQDWLWHKENCYLFHGPFSWEKNRQTCQSLGGQLLQINGADDL
T
FILQAISHTTSPFWIGLHRKKPGQPWLWENGTPLNFQ
FFKTRGVSLQLYSSGNCAYLQDGAVFAENCIL
I
AFSICQKKTNHLQI




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser