NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS80504.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
80504.1 Public Mus musculus 6 Irf5 21 106 86 CCDS HistoryNCBI Gene:27056Re-query CCDS DB by CCDS ID:80504.1Re-query CCDS DB by GeneID:27056See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 19, NCBI annotation release 105, Ensembl annotation release 81

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 80504.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000167252 ENSMUSP00000126273 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000167252Link to Ensembl Protein Viewer:ENSMUSP00000126273Re-query CCDS DB by Nucleotide ID:ENSMUST00000167252Re-query CCDS DB by Protein ID:ENSMUSP00000126273
Original member Current member EBI,WTSI OTTMUST00000138172 OTTMUSP00000072675 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000138172Link to Vega Protein Viewer:OTTMUSP00000072675Re-query CCDS DB by Nucleotide ID:OTTMUST00000138172Re-query CCDS DB by Protein ID:OTTMUSP00000072675
Original member Current member NCBI NM_001311083.1 NP_001298012.1 Accepted alive Link to Nucleotide Sequence:NM_001311083.1Link to Protein Sequence:NP_001298012.1Re-query CCDS DB by Nucleotide ID:NM_001311083Re-query CCDS DB by Protein ID:NP_001298012Link to BLAST:NP_001298012.1

Chromosomal Locations for CCDS 80504.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 6 (NC_000072.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 29531137 29531331 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 29533952 29534141 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 29534535 29534593 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 29535041 29535074 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 29535253 29535510 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 29535725 29536117 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 29536204 29536322 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 29536540 29536650 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 29541616 29541741 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1485 nt):
ATGAACCACTCAGCCCCAGGGATTCCCCCACCACCCCGCCGTGTGAGGCTGAAGCCCTGGTTGGTGGCCC
AG
GTGAACAGCTGCCAGTACCCAGGGCTTCAGTGGGTCAACGGGGAAAAGAAACTCTTCTATATACCCTG
G
CGCCATGCCACGAGGCATGGTCCCAGCCAGGATGGGGACAACACCATCTTCAAGGCCTGGGCTAAAGAG
ACA
GGGAAGTACACTGAAGGGGTGGATGAGGCTGACCCAGCCAAGTGGAAGGCCAACCTGCGCTGTGCCC
TT
AACAAAAGCCGTGACTTCCAGCTGTTCTATGATGGCCCTCGGGACATGCCACCTCAGCCGTACAAGAT
C
TACGAGGTCTGCTCCAACGGCCCTGCTCCCACAGAGAGCCAACCCACTGATGATTACGTTCTGGGAGAA
GAG
GAGGAGGAGGAAGAGGAAGAGCTCCAGAGAATGCTACCAGGCCTGAGCATCACAGAGCCTGCGCTAC
CT
GGGCCTCCCAACGCACCCTATTCCTTACCCAAAGAAGACACCAAGTGGCCACCTGCTCTCCAGCCACC
T
GTAGGGCTGGGTCCCCCTGTCCCAGACCCAAATCTCCTGGCCCCTCCCTCTGGAAATCCTGCTGGCTTC
AGG
CAGCTTCTCCCTGAGGTCCTGGAGCCTGGACCTCTGGCTTCCAGCCAGCCCCCTACAGAACCACTCT
TG
CCTGACCTGCTGATCAGCCCCCACATGTTGCCTTTGACGGACCTAGAGATCAAGTTCCAGTACCGGGG
A
CGCGCACCCCGGACCCTCACCATCAGCAACCCACAAGGCTGCAGGCTCTTCTACAGCCAGCTAGAGGCT
ACC
CAGGAGCAAGTGGAACTCTTTGGCCCTGTGACCCTGGAGCAAGTGCGCTTCCCTAGCCCAGAGGACA
TC
CCCAGTGACAAGCAGCGTTTCTATACGAACCAGCTGCTAGATGTCCTGGACCGTGGGCTCATCCTGCA
G
CTGCAGGGCCAGGACCTGTACGCCATCCGTCTGTGCCAGTGTAAGGTGTTCTGGAGTGGGCCCTGCGCC
TTG
GCCCATGGCTCCTGCCCCAACCCCATTCAGCGGGAAGTCAAGACGAAGCTCTTTAGCCTAGAGCAGT
TT
CTCAATGAGCTCATCCTGTTCCAGAAGGGCCAGACTAATACCCCACCACCTTTTGAGATCTTCTTTTG
C
TTTGGAGAAGAATGGCCTGATGTCAAACCCCGAGAGAAGAAGCTCATTACTGTACAGGTGGTACCTGTT
GCA
GCCCGGTTGCTGCTGGAGATGTTCTCAGGGGAGCTTTCTTGGTCGGCAGACAGCATCCGACTGCAGA
TC
TCAAACCCGGATCTCAAAGACCACATGAAAGAAGTTCACCAGGAAACTAGTTCCCCTCCCACCACGTC
G
GACAGGCTCCAGCCATCCTTAAAAACCGCGCTGTTTCTCCCTCACATCCCAAACAGGGACTCCTTAGGA
TGC
CTTGGAGGGTGA


Translation (494 aa):
MNHSAPGIPPPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFYIPWRHATRHGPSQDGDNTIFKAWAKE
T
GKYTEGVDEADPAKWKANLRCALNKSRDFQLFYDGPRDMPPQPYKIYEVCSNGPAPT
ESQPTDDYVLGE
E
EEEEEEE
LQRMLPGLSITEPALPGPPNAPYSLPKEDTKWPPALQPPVGLGPPVPDPNLLAPPSGNPAGF
R
QLLPEVLEPGPLASSQPPTEPLLPDLLISPHMLP
LTDLEIKFQYRGRAPRTLTISNPQGCRLFYSQLEA
T
QEQVELFGPVTLEQVRFPSPEDIPSDKQRFYTNQLLDVLDRGLILQLQGQDLYAIRLCQCKVFWSGPCA
L
AHGSCPNPIQREVKTKLFSLEQFLN
ELILFQKGQTNTPPPFEIFFCFGEEWPDVKPREKKLITVQVVPV
A
ARLLLEMFSGELSWSADSIRLQISNPDLKDHM
KEVHQETSSPPTTSDRLQPSLKTALFLPHIPNRDSLG
C
LGG




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser