NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS79506.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
79506.1 Public Mus musculus 17 Prkn 21 106 86 CCDS HistoryNCBI Gene:50873Re-query CCDS DB by CCDS ID:79506.1Re-query CCDS DB by GeneID:50873See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 19, NCBI annotation release 105, Ensembl annotation release 81

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 79506.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000191124 ENSMUSP00000140587 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000191124Link to Ensembl Protein Viewer:ENSMUSP00000140587Re-query CCDS DB by Nucleotide ID:ENSMUST00000191124Re-query CCDS DB by Protein ID:ENSMUSP00000140587
Original member Current member EBI,WTSI OTTMUST00000120776 OTTMUSP00000066774 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000120776Link to Vega Protein Viewer:OTTMUSP00000066774Re-query CCDS DB by Nucleotide ID:OTTMUST00000120776Re-query CCDS DB by Protein ID:OTTMUSP00000066774
Original member Current member NCBI NM_016694.4 NP_057903.1 Accepted alive Link to Nucleotide Sequence:NM_016694.4Link to Protein Sequence:NP_057903.1Re-query CCDS DB by Nucleotide ID:NM_016694Re-query CCDS DB by Protein ID:NP_057903Link to BLAST:NP_057903.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_057903.1 464 Q9WVS6-1 464 100% 0 0

Chromosomal Locations for CCDS 79506.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 17 (NC_000083.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 10840483 10840489 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 11067129 11067292 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 11237462 11237702 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 11303593 11303711 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 11434550 11434633 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 11492679 11492794 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 11635310 11635446 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 11838602 11838663 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 11854727 11854876 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 12004045 12004128 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 12050626 12050743 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 12061541 12061653 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1395 nt):
ATGATAGTGTTTGTCAGGTTCAACTCCAGCTATGGCTTCCCAGTGGAGGTCGATTCTGACACCAGCATCT
TG
CAGCTCAAGGAAGTGGTTGCTAAGCGACAGGGGGTTCCAGCTGACCAGCTGCGTGTGATTTTTGCCGG
G
AAGGAGCTTCCGAATCACCTGACGGTTCAAAACTGTGACCTGGAACAACAGAGTATTGTACACATAGTA
CAG
AGACCACGGAGGAGAAGTCATGAAACAAATGCATCTGGAGGGGACGAACCCCAGAGCACCTCAGAGG
GC
TCCATATGGGAGTCCAGGAGCTTGACACGAGTGGACCTGAGCAGCCATACCCTGCCGGTGGACTCTGT
G
GGGCTGGCGGTCATTCTGGACACAGACAGTAAGAGGGATTCAGAAGCAGCCAGAGGTCCAGTTAAACCC
ACC
TACAACAGCTTTTTCATCTACTGCAAAGGCCCCTGCCACAAGGTCCAGCCTGGAAAGCTCCGAGTTC
AG
TGTGGCACCTGCAAACAAGCAACCCTCACCTTGGCCCAGGGCCCATCTTGCTGGGACGATGTCTTAAT
T
CCAAACCGGATGAGTGGTGAGTGCCAGTCTCCAGACTGCCCTGGAACCAGAGCTGAATTTTTCTTTAAA
TGT
GGAGCACACCCAACCTCAGACAAGGACACGTCGGTAGCTTTGAACCTGATCACCAGCAACAGGCGCA
GC
ATCCCTTGCATAGCGTGCACAGATGTCAGGAGCCCTGTCCTGGTCTTCCAGTGTAACCACCGTCACGT
G
ATCTGTTTGGACTGTTTCCACTTGTATTGTGTCACAAGACTCAACGATCGGCAGTTTGTCCACGATGCT
CAA
CTTGGCTACTCCCTGCCGTGTGTAGCTGGCTGTCCCAACTCCCTGATTAAAGAGCTCCATCACTTCA
GG
ATCCTTGGAGAAGAGCAGTACACTAGGTACCAGCAGTATGGGGCCGAGGAATGCGTGCTGCAAATGGG
A
GGTGTGCTGTGCCCCCGTCCTGGCTGTGGAGCTGGACTGCTACCTGAACAGGGCCAGAGGAAAGTCACC
TGC
GAAGGGGGCAACGGCCTGGGCTGCGGGTTTGTTTTCTGCCGGGACTGTAAGGAAGCATACCATGAAG
GG
GATTGCGACTCACTGCTCGAACCCTCAGGAGCCACTTCTCAGGCCTACAGGGTGGACAAAAGAGCCGC
T
GAGCAAGCTCGCTGGGAGGAGGCCTCCAAGGAAACCATCAAGAAGACCACCAAGCCTTGTCCTCGCTGC
AAC
GTGCCAATTGAAAAAAACGGAGGATGTATGCACATGAAGTGTCCTCAGCCCCAGTGCAAGCTGGAGT
GG
TGCTGGAACTGTGGCTGTGAGTGGAACCGAGCCTGCATGGGAGATCACTGGTTTGACGTGTAG


Translation (464 aa):
MIVFVRFNSSYGFPVEVDSDTSILQLKEVVAKRQGVPADQLRVIFAGKELPNHLTVQNCDLEQQSIVHIV
Q
RPRRRSHETNASGGDEPQSTSEGSIWESRSLTRVDLSSHTLPVDSVGLAVILDTDSKRDSEAARGP
VKP
T
YNSFFIYCKGPCHKVQPGKLRVQCGTCKQATLTLAQ
GPSCWDDVLIPNRMSGECQSPDCPGTRAEFFFK
C
GAHPTSDKDTSVALNLITSNRRSIPCIACTDV
RSPVLVFQCNHRHVICLDCFHLYCVTRLNDRQFVHDA
Q
LGYSLPCV
AGCPNSLIKELHHFRILGEEQYTRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEQGQRKVT
C
EGGNGLGCG
FVFCRDCKEAYHEGDCDSLLEPSGATSQAYRVDKRAAEQARWEEASKETIKKTTKPCPRC
N
VPIEKN
GGCMHMKCPQPQCKLEWCWNCGCEWNRACMGDHWFDV



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser