NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS79295.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
79295.1 Public Mus musculus 14 Mapk8 21 106 86 CCDS HistoryNCBI Gene:26419Re-query CCDS DB by CCDS ID:79295.1Re-query CCDS DB by GeneID:26419See the combined annotation on chromosome 14 in Sequence Viewer

Public since: CCDS release 19, NCBI annotation release 105, Ensembl annotation release 81

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 79295.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000111944 ENSMUSP00000107575 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000111944Link to Ensembl Protein Viewer:ENSMUSP00000107575Re-query CCDS DB by Nucleotide ID:ENSMUST00000111944Re-query CCDS DB by Protein ID:ENSMUSP00000107575
Original member Current member EBI,WTSI OTTMUST00000044048 OTTMUSP00000019792 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000044048Link to Vega Protein Viewer:OTTMUSP00000019792Re-query CCDS DB by Nucleotide ID:OTTMUST00000044048Re-query CCDS DB by Protein ID:OTTMUSP00000019792
Original member Current member NCBI NM_001310454.1 NP_001297383.1 Accepted alive Link to Nucleotide Sequence:NM_001310454.1Link to Protein Sequence:NP_001297383.1Re-query CCDS DB by Nucleotide ID:NM_001310454Re-query CCDS DB by Protein ID:NP_001297383Link to BLAST:NP_001297383.1

Chromosomal Locations for CCDS 79295.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 14 (NC_000080.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14See the combined annotation on chromosome 14 in Sequence Viewer

Chromosome Start Stop Links
14 33382174 33382319 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 33383874 33383951 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 33386562 33386625 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 33387172 33387296 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 33388800 33388982 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 33390673 33390744 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 33392942 33393107 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 33402624 33402762 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 33402865 33402923 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 33408048 33408177 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 33410856 33410977 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1284 nt):
ATGAGCAGAAGCAAACGTGACAACAATTTTTATAGTGTAGAGATTGGAGATTCTACATTCACAGTCCTAA
AA
CGATACCAGAATTTAAAGCCTATAGGCTCAGGAGCTCAAGGAATAGTGTGTGCAGCTTATGATGCCAT
T
CTTGAAAGAAATGTTGCAATCAAGAAGCTCAGCCGGCCATTTCAGAATCAGACCCATGCTAAGCGCGCC
TAC
CGAGAACTAGTTCTTATGAAGTGTGTTAATCACAAAAATATAATTGGCCTTTTGAATGTTTTCACAC
CA
CAGAAATCCCTAGAAGAATTTCAAGATGTTTACATAGTCATGGAGCTCATGGATGCAAATCTTTGCCA
A
GTGATTCAGATGGAGTTAGATCATGAAAGAATGTCCTACCTTCTCTATCAAATGCTGTGTGGAATCAAG
CAC
CTTCACTCTGCTGGAATTATTCATCGGGACTTAAAGCCTAGTAATATAGTAGTCAAATCAGACTGCA
CT
TTGAAGATTCTTGATTTTGGACTGGCGAGGACTGCAGGAACGAGTTTTATGATGACGCCTTATGTGGT
G
ACTCGCTACTACAGAGCACCAGAGGTCATTCTCGGCATGGGCTACAAGGAGAACGTGGACTTATGGTCT
GTG
GGGTGCATTATGGGAGAAATGGTTTGCCACAAAATCCTCTTTCCAGGAAGGGACTATATTGATCAGT
GG
AATAAAGTTATTGAACAGCTCGGAACACCTTGTCCTGAATTCATGAAGAAACTACAACCAACAGTAAG
G
ACTTATGTTGAAAACAGGCCTAAATACGCTGGATATAGCTTTGAGAAACTGTTCCCCGATGTGCTTTTC
CCA
GCTGACTCAGAGCATAACAAACTTAAAGCCAGTCAGGCAAGAGATTTGTTATCCAAAATGCTAGTAA
TA
GATGCATCCAAAAGGATCTCCGTAGATGAAGCTCTCCAGCACCCATACATCAACGTCTGGTATGATCC
T
TCAGAAGCAGAAGCCCCACCACCAAAGATCCCGGACAAGCAGTTAGATGAGAGGGAGCACACAATAGAG
GAG
TGGAAAGAACTGATATACAAGGAGGTAATGGATTTGGAGGAACGAACTAAGAATGGAGTCATAAGAG
GG
CAGCCGTCTCCTTTAGGTGCAGCAATGATCAATGGCTCTCAGCATCCATCGTCTTCGCCGTCTGTCAA
T
GACATGTCTTCAATGTCCACAGATCCGACTTTGGCCTCGGATACAGACAGCAGTCTAGAAGCATCAGCT
GGA
CCTCTGGGCTGCTGTAGATGA


Translation (427 aa):
MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRPFQNQTHAKRA
Y
RELVLMKCVNHKN
IIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQMELDHERMSYLLYQMLCGIK
H
LHSAGIIHR
DLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDLWS
V
GCIMGEMVCHKILFPGRD
YIDQWNKVIEQLGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLF
P
ADSEHNKLK
ASQARDLLSKMLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIE
E
WK
ELIYKEVMDLEERTKNGVIRGQPSPLGAAMINGSQHPSSSPSVNDMSSMSTDPTLASDTDSSLEASA
G
PLGCCR




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser