NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS72380.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
72380.1 Public Mus musculus X Phf6 21 106 86 CCDS HistoryNCBI Gene:70998Re-query CCDS DB by CCDS ID:72380.1Re-query CCDS DB by GeneID:70998See the combined annotation on chromosome X in Sequence Viewer

Public since: CCDS release 16, NCBI annotation release 104, Ensembl annotation release 75

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 72380.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000154864 ENSMUSP00000130358 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000154864Link to Ensembl Protein Viewer:ENSMUSP00000130358Re-query CCDS DB by Nucleotide ID:ENSMUST00000154864Re-query CCDS DB by Protein ID:ENSMUSP00000130358
Original member Current member EBI,WTSI OTTMUST00000042252 OTTMUSP00000049153 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000042252Link to Vega Protein Viewer:OTTMUSP00000049153Re-query CCDS DB by Nucleotide ID:OTTMUST00000042252Re-query CCDS DB by Protein ID:OTTMUSP00000049153
Original member Current member NCBI NM_001290546.1 NP_001277475.1 Accepted alive Link to Nucleotide Sequence:NM_001290546.1Link to Protein Sequence:NP_001277475.1Re-query CCDS DB by Nucleotide ID:NM_001290546Re-query CCDS DB by Protein ID:NP_001277475Link to BLAST:NP_001277475.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001277475.1 284 Q9D4J7-2 284 100% 0 0

Chromosomal Locations for CCDS 72380.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome X (NC_000086.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome XSee the combined annotation on chromosome X in Sequence Viewer

Chromosome Start Stop Links
X 52931573 52931706 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 52931981 52932024 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 52940225 52940391 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 52940537 52940680 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 52942564 52942668 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 52945884 52946017 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 52953452 52953578 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (855 nt):
ATGTGTTCTCTTTGTCATTGTCCTGGAGCAACCATTGGCTGTGATGTGAAAACCTGCCACAGGACATACC
AC
TACCACTGTGCATTGCATGATAAAGCTCAGATCCGAGAGAAACCTTCGCAAGGGATTTACATGGTTTA
T
TGTCGAAAACACAAGAAAACTGCACATAACTCGGAAGCTGATTTAGAAGAAAGTTTTAATGAGCATGAA
CTG
GAGCCCTCATCTCCAAAGACTAAGAAGAAAAGTCGCAAAGGAAGACCGAGAAAAACTAACCTTAAAG
GC
TTGCCAGAAGACAGCAGGTCCACATCCTCCCATGGAACAGATGAAATGGAAAGTAGCTCCTACCGAGA
T
AGGTCTCCACACAGGAGCAGTCCTAATGATACCAGGCCTAAATGTGGATTTTGCCATGTAGGGGAGGAA
GAA
AATGAAGCAAGAGGGAAATTGCATATATTTAATGCCAAGAAGGCAGCCGCACATTACAAGTGCATGT
TG
TTTTCTTCTGGCACTGTTCAGCTCACAACAACATCAAGAGCAGAATTTGGAGATTTCGATATTAAAAC
T
GTACTTCAGGAGATTAAGCGAGGAAAAAGGATGAAATGTACACTTTGCAGTCAGCCTGGTGCTACTATT
GGA
TGCGAAATAAAAGCCTGTGTTAAAACCTACCATTACCACTGTGGTGTACAAGACAAGGCAAAATACA
TT
GAAAATATGTCACGAGGAATTTACAAACTCTATTGTAAAAACCATAGTGGAAATGATGAGCGAGATGA
A
GAAGATGAGGAGCGAGAGAGTAAAAGCCGTGGAAGAGTAGCGATTGATCAGCAGCTAACCCAGCAGCAG
CTT
AATGGAAACTAG


Translation (284 aa):
MCSLCHCPGATIGCDVKTCHRTYHYHCALHDKAQIREKPSQGIYMVYCRKHKKTAHNSEADLEESFNEHE
L
EPSSPKTKKKSRKGRPRKTNLKGLPEDSRSTSSHGTDEMESSSY
RDRSPHRSSPNDTRPKCGFCHVGEE
E
NEARGKLHIFNAKKAAAHYKCM
LFSSGTVQLTTTSRAEFGDFDIKTVLQEIKRGKRMKCTLCSQPGATI
G
CEIKACVKTYHYHCGVQDKAKYIENMSRGIY
KLYCKNHSGNDERDEEDEERESKSRGRVAIDQQLTQQQ
L
NGN




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser