NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS71598.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
71598.1 Public Mus musculus 5 Rbm47 21 106 86 CCDS HistoryNCBI Gene:245945Re-query CCDS DB by CCDS ID:71598.1Re-query CCDS DB by GeneID:245945See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 16, NCBI annotation release 104, Ensembl annotation release 75

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 71598.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000094756 ENSMUSP00000092348 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000094756Link to Ensembl Protein Viewer:ENSMUSP00000092348Re-query CCDS DB by Nucleotide ID:ENSMUST00000094756Re-query CCDS DB by Protein ID:ENSMUSP00000092348
Original member Current member EBI,WTSI OTTMUST00000052910 OTTMUSP00000025142 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000052910Link to Vega Protein Viewer:OTTMUSP00000025142Re-query CCDS DB by Nucleotide ID:OTTMUST00000052910Re-query CCDS DB by Protein ID:OTTMUSP00000025142
Original member Current member NCBI NM_001291226.1 NP_001278155.1 Accepted alive Link to Nucleotide Sequence:NM_001291226.1Link to Protein Sequence:NP_001278155.1Re-query CCDS DB by Nucleotide ID:NM_001291226Re-query CCDS DB by Protein ID:NP_001278155Link to BLAST:NP_001278155.1

Chromosomal Locations for CCDS 71598.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 66019206 66019436 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 66022628 66022833 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 66026130 66027258 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1566 nt):
ATGACTGCTGAAGATTCCGCCACAGCCATGAACAGCGATCCAACAGTGGGGTCCTCCACCAAGGTACCGG
AG
GGTGTGGCGGGCGCGCCCAATGAGGCTGCACTGTTGGCACTGATAGAGCGCACCGGCTACACCATGGT
A
CAAGAGAACGGGCAGCGCAAGTACGGTGGACCCCCGCCCGGCTGGGAGGGCCCGCATCCCCAGCGTGGC
TGT
GAGGTCTTCGTGGGCAAGATCCCACGTGACGTGTATGAAGATGAGCTGGTGCCTGTGTTTGAGACCG
TA
GGTCGCATCTATGAGCTGCGACTCATGATGGATTTCGATGGCAAGAACCGCGGCTATGCCTTCGTGAT
G
TACTGCCACAAGCATGAGGCCAAGCGAGCCGTTCGGGAACTCAACAACTACGAGATCCGCCCCGGCCGT
CTG
CTGGGTGTGTGCTGTAGTGTGGACAACTGCCGCCTCTTCATTGGTGGCATCCCCAAGATGAAGAAGC
GC
GGGGAGATCCTGGAGGAGATCGCCAAGGTCACCGAGGGCGTACTCAACGTGATTGTGTATGCCAGTGC
G
GCAGACAAGATGAAAAACCGAGGCTTCGCCTTTGTGGAGTATGAGAGCCATCGTGCTGCAGCCATGGCA
CGC
CGCAAGCTCATGCCGGGTCGGATCCAACTGTGGGGCCACCAGATTGCTGTGGACTGGGCCGAGCCAG
AG
ATTGACGTGGACGAAGATGTGATGCAGACAGTGAAGATCCTCTACGTGCGCAACCTCATGATCGAGAC
C
ACCGAGGAGACCATCAAGAAGAGCTTTGGCCAGTTCAACCCAGGCTGCGTGGAAAGGGTCAAGAAGATC
CGT
GACTACGCCTTCGTGCACTTCACTAGCCGTGAGGATGCTGTGCATGCTATGAACAACCTCAACGGCA
CA
GAGCTGGAGGGATCCTGCTTAGAAGTCACGCTGGCCAAGCCCGTGGACAAGGAACAGTACTCCCGCTA
C
CAGAAGGCAGCCAAGGGTGGTGGTGGCTCGGCTGAGGCCGTAGCGCAGCAACCCAGCTACGTGTACTCC
TGT
GACCCCTACACGTTGGCCTACTACGGCTACCCCTACAACGCTCTCATCGGGCCCAACCGGGACTACT
TC
GTGAAAATGGCCATCCCTGCCATCGGTGCTCAGTACTCCATGTTCCAGGCAGCCCCAGCCCCGAAAAT
A
ATCGAAGATGGCAAGATCCACACAATGGAACACATGATCAGCCCCATTGCGGTGCAGCCTGACCCCGCC
ACT
GCTGCTGCCGCTGCAGCCGCTGCAGCCGCTGCTGCCGTCATTCCTGCGGTATCCACACCGCCACCTT
TC
CAGGGCCGTCCAATAACTCCTGTGTACACCGTGGCACCAAATGTTCAGAGAATCCCCACCGCCGGCAT
C
TACGGGGCCAGCTACGTCCCCTTTGCTGCTCCCGCCACTGCCACAATCGCCACACTACAGAAGAACGCC
GCG
GCTGCCGTGTATGGGGGCTACGCCGGCTACATACCTCAGGCCTTCCCCGCTGCTCTCCAGGTGCCCA
TC
CACGACGTCTACCAGACTTACTGA


Translation (521 aa):
MTAEDSATAMNSDPTVGSSTKVPEGVAGAPNEAALLALIERTGYTMVQENGQRKYGGPPPGWEGPHPQRG
C
EVFVGKIPRDVYEDELVPVFETVGRIYELRLMMDFDGKNRGYAFVMYCHKHEAKRAVRELNNYEIRPGR
L
LGVCCSVDNCRLFIGGIPKMKKRGEILEEIAKVTEGVLNVIVYASAADKMKNRGFAFVEYESHRAAAMA
R
RKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMQTVKILYVRNLMIETTEETIKKSFGQFNPGCVERVKKI
R
DYAFVHFTSREDAVHAMNNLNGTELEGSCLEVTLAKPVDKEQYSRYQKAAKGGGGSAEAVAQQPSYVYS
C
DPYTLAYYGYPYNALIGPNRDYFVK
MAIPAIGAQYSMFQAAPAPKIIEDGKIHTMEHMISPIAVQPDPA
T
AAAAAAAAAAAAVIPAVSTPPPFQ
GRPITPVYTVAPNVQRIPTAGIYGASYVPFAAPATATIATLQKNA
A
AAVYGGYAGYIPQAFPAALQVPIHDVYQTY




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser