NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS71530.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
71530.1 Public Mus musculus 4 Prdm16 21 106 86 CCDS HistoryNCBI Gene:70673Re-query CCDS DB by CCDS ID:71530.1Re-query CCDS DB by GeneID:70673See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 16, NCBI annotation release 104, Ensembl annotation release 75

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 71530.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000105637 ENSMUSP00000101262 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000105637Link to Ensembl Protein Viewer:ENSMUSP00000101262Re-query CCDS DB by Nucleotide ID:ENSMUST00000105637Re-query CCDS DB by Protein ID:ENSMUSP00000101262
Original member Current member EBI,WTSI OTTMUST00000024680 OTTMUSP00000011332 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000024680Link to Vega Protein Viewer:OTTMUSP00000011332Re-query CCDS DB by Nucleotide ID:OTTMUST00000024680Re-query CCDS DB by Protein ID:OTTMUSP00000011332
Original member Current member NCBI NM_001291026.1 NP_001277955.1 Accepted alive Link to Nucleotide Sequence:NM_001291026.1Link to Protein Sequence:NP_001277955.1Re-query CCDS DB by Nucleotide ID:NM_001291026Re-query CCDS DB by Protein ID:NP_001277955Link to BLAST:NP_001277955.1

Chromosomal Locations for CCDS 71530.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 154320788 154320922 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154322271 154322445 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154323247 154323480 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154328260 154328434 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154328664 154328833 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154334375 154334452 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154335093 154335262 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154337643 154337727 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154340721 154342137 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154345322 154345475 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154345995 154346142 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154347924 154348134 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154355247 154355349 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154367178 154367312 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154476639 154476686 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154528582 154528931 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154636723 154636759 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3825 nt):
ATGCGATCCAAGGCGAGGGCGAGGAAGCTAGCCAAAAGTGACGGTGACGTTGTAAATAATATGTATGAAC
CT
GACCCGGACCTGCTGGCCGGCCAGAGTGCCGAGGAGGAGACCGAAGACGGCATCCTGTCCCCCATCCC
C
ATGGGGCCACCGTCCCCCTTCCCCACCAGCGAGGACTTCACTCCCAAGGAGGGCTCGCCCTATGAGGCT
CCT
GTCTACATTCCTGAAGACATTCCAATCCCACCAGACTTCGAGCTACGAGAGTCCTCCATACCAGGAG
CT
GGCCTGGGGATCTGGGCCAAGCGGAAGATGGAAATCGGGGAGAGGTTTGGCCCCTACGTGGTGACGCC
C
CGGGCCGCACTGAAGGAGGCCGACTTTGGATGGGAGATGCTGACGGATACAGAGGTGTCATCCCAGGAG
AGC
TGCATCAAAAAGATCTCTGAAGACTTGGGTAGCGAGAAGTTCTGCGTGGATGCCAATCAGGCGGGGT
CT
GGCAGCTGGCTCAAGTACATCCGTGTAGCGTGTTCCTGTGATGACCAAAACCTCGCCATGTGTCAGAT
C
AACGAACAGATTTACTATAAAGTCATTAAGGACATCGAGCCTGGAGAGGAACTGTTGGTGCATGTGAAA
GAA
GGTGCCTACTCCTTGGGTGTCATGGCCCCCAGCTTGGATGAGGACCCCACATTCCGCTGTGATGAGT
GT
GATGAGCTCTTCCAGTGCAGGCTGGACCTGAGGCGCCACAAGAAGTACGCGTGCAGCTCTGCAGGAGC
C
CAGCTCTACGAGGGCCTAGGGGAGGAACTCAAGCCCGAGGGCCTTGGCGTGGGCAGCGACGGGCAAGCG
CAT
GAGTGCAAGGATTGCGAGCGGATGTTCCCCAACAAGTACAGCTTGGAGCAACACATGATCGTCCACA
CG
GAAGAGCGTGAGTACAAATGTGACCAGTGTCCCAAGGCCTTCAACTGGAAGTCCAACCTCATCCGCCA
C
CAGATGTCTCACGACAGTGGCAAGCGCTTCGAATGTGAAAACTGTGTCAAGGTGTTCACGGACCCCAGC
AAC
CTCCAGCGTCACATCCGCTCACAGCATGTCGGTGCCCGGGCCCATGCCTGCCCTGACTGTGGCAAGA
CC
TTCGCCACATCCTCTGGCCTCAAACAGCACAAGCATATCCACAGCACGGTGAAGCCATTCATATGCGA
G
GTCTGCCACAAGTCCTACACGCAGTTCTCCAACCTGTGCCGGCACAAGCGGATGCACGCCGACTGCAGG
ACG
CAGATCAAGTGCAAGGACTGTGGGCAGATGTTCAGCACTACCTCCTCCCTCAACAAGCATCGGAGAT
TC
TGCGAGGGCAAGAACCATTACACGCCTGGCAGCATCTTCACCCCAGGCCTGCCCTTGACCCCCAGCCC
C
ATGATGGACAAGACAAAACCCTCCCCGACCCTCAACCACGGGGGCCTAGGCTTCAGCGAGTACTTCCCC
TCC
AGACCTCATCCTGGGAGCCTGCCCTTCTCGGCTGCTCCTCCGGCCTTCCCCGCACTCACTCCGGGCT
TC
CCGGGCATCTTTCCTCCATCCCTGTACCCACGACCACCTCTGCTACCTCCCACGCCGCTGCTCAAGAG
C
CCCCTGAACCACGCGCAGGACGCCAAGCTACCCAGCCCGCTGGGAAACCCAGCCCTGCCCCTTGTCTCC
GCG
GTCAGCAATAGCAGCCAGGGTGCCACAGCGGCCACCGGGTCAGAGGAGAAATTTGATGGCCGCTTGG
AA
GACGCATATGCGGAGAAGGTCAAAAATAGGAGCCCTGACATGTCGGATGGCAGTGACTTTGAGGATAT
C
AACACCACGACCGGGACAGACTTGGACACTACCACGGGCACGGGGTCAGACCTGGACAGCGACCTGGAC
AGT
GACAGAGACAAAGGCAAGGACAAGGGGAAGCCAGTGGAGAGCAAACCTGAGTTTGGGGGTGCATCTG
TG
CCCCCTGGGGCCATGAACAGTGTGGCCGAGGTACCGGCCTTCTACTCACAGCATTCCTTCTTCCCGCC
A
CCCGAGGAACAGCTGCTGACGGCCTCGGGAGCTGCCGGCGACTCCATCAAGGCCATCGCGTCCATCGCG
GAG
AAATACTTCGGTCCTGGCTTCATGAGCATGCAGGAGAAGAAGCTGGGCTCACTACCCTACCACTCCG
TG
TTCCCCTTCCAGTTCCTGCCTAACTTTCCCCACTCCCTCTACCCCTTTACGGACCGAGCCCTCGCCCA
C
AACTTGCTGGTCAAGGCTGAGCCAAAGTCACCCCGGGATGCCCTCAAGGTGGGCGGCCCCAGTGCGGAG
TGC
CCCTTCGACCTCACCACCAAACCAAAAGAGGCCAAACCCGCCCTGCTCGCACCCAAGGTCCCCCTCA
TC
CCCTCATCTGGCGAGGAACAGCCACTGGACCTGAGCATCGGCAGCAGGGCCAGGGCAAGCCAGAACGG
A
GGTGGCCGTGAGCCGCGGAAGAACCACGTCTACGGTGAACGGAAGCCGGGGGTCAGCGAGGGGCTGCCT
AAG
GTGTGCCCAGCACAGCTGCCCCAGCAGCCCTCCTTGCATTATGCTAAGCCTTCACCGTTCTTCATGG
AT
CCCATCTACAGGGTAGAAAAGCGGAAGGTGGCAGACCCTGTGGGAGTCCTGAAAGAGAAGTACCTGCG
G
CCGTCCCCACTTCTGTTCCACCCCCAGATGTCAGCCATAGAAACCATGACGGAGAAGCTGGAGAGCTTT
GCA
GCCATGAAGGCCGACTCAGGCAGCTCCCTGCAGCCCCTGCCTCACCACCCGTTCAACTTCCGCTCCC
CA
CCCCCAACGCTCTCGGATCCCATCCTCAGGAAGGGGAAGGAGAGATACACGTGCAGGTACTGTGGCAA
G
ATCTTCCCCAGATCTGCAAATCTCACAAGACATCTGAGGACACACACAGGGGAGCAGCCATACAGGTGC
AAG
TACTGTGACCGGTCATTCAGCATCTCCTCCAACCTCCAGCGGCACGTGAGGAACATCCACAACAAAG
AG
AAGCCGTTCAAGTGCCATCTGTGCAACCGCTGCTTCGGGCAGCAGACCAACCTAGACCGGCACCTGAA
G
AAGCACGAACACGAGGGCGCACCAGTGAGCCAGCACTCCGGGGTGCTCACGAACCACCTGGGCACCAGC
GCC
TCCTCCCCCACCTCCGAGTCGGACAACCATGCACTTTTAGATGAGAAGGAAGATTCTTACTTCTCCG
AG
ATCCGAAACTTCATCGCCAACAGCGAGATGAACCAGGCATCCACTCGAATGGACAAACGGCCTGAGAT
C
CAAGACCTGGACAGCAACCCACCGTGTCCAGGCTCAGCCAGTGCAAAGCCAGAGGACGTAGAGGAGGAG
GAA
GAGGAGGAGCTGGAGGAAGAGGATGATGACAGCTTAGCCGGGAAGTCACAGGAGGACACGGTGTCCC
CC
ACACCTGAGCCCCAAGGAGTCTATGAAGATGAAGAGGATGAGGAACCACCCAGCCTGACCATGGGCTT
T
GACCATACCCGGAGGTGTGTTGAGGAGCGAGGAGGCGGCCTGTTAGCTTTGGAGCCGACGCCGACCTTT
GGG
AAGGGGCTGGATCTCCGCAGAGCAGCTGAGGAAGCATTTGAAGTTAAAGATGTGCTTAATTCCACCT
TA
GATTCTGAGGTTTTAAAACAAACCCTGTACAGGCAGGCTAAGAACCAGGCATATGCAATGATGCTGTC
C
CTCTCTGAAGACACTCCTCTCCACGCCCCCTCCCAGAGCTCACTGGATGCTTGGTTGAACATCACAGGA
CCC
TCGTCAGAGTCCGGAGCCTTTAACCCCATCAACCACCTCTGA


Translation (1274 aa):
MRSKARARKLAKSDGDVVNNMYEPDPDLLAGQSAEEETEDGILSPIPMGPPSPFPTSEDFTPKEGSPYEA
P
VYIPEDIPIPPDFELRESSIPGAGLGIWAKRKMEIGERFGPYVVTPRAALKEADFGWE
MLTDTEVSSQE
S
CIKK
ISEDLGSEKFCVDANQAGSGSWLKYIRVACSCDDQNLAMCQINEQIYYKVIKDIEPGEELLVHVK
E
GAYSLGVMAPSLD
EDPTFRCDECDELFQCRLDLRRHKKYACSSAGAQLYEGLGEELKPEGLGVGSDGQA
H
ECKDCERMFPNKY
SLEQHMIVHTEEREYKCDQCPKAFNWKSNLIRHQMSHDSGKRFECENCVKVFTDPS
N
LQRHIRSQHVGARAHACPDCGKTFATSSGLKQHKHIHSTVKPFI
CEVCHKSYTQFSNLCRHKRMHADCR
T
QIKCKDCGQMFSTTSSLNKHRRFCEGKNHYTPGSIFTPGLPLTPSPMMDKTKPSPTLNHGGLGFSEYFP
S
RPHPGSLPFSAAPPAFPALTPGFPGIFPPSLYPRPPLLPPTPLLKSPLNHAQDAKLPSPLGNPALPLVS
A
VSNSSQGATAATGSEEKFDGRLEDAYAEKVKNRSPDMSDGSDFEDINTTTGTDLDTTTGTGSDLDSDLD
S
DRDKGKDKGKPVESKPEFGGASVPPGAMNSVAEVPAFYSQHSFFPPPEEQLLTASGAAGDSIKAIASIA
E
KYFGPGFMSMQEKKLGSLPYHSVFPFQFLPNFPHSLYPFTDRALAHNLLVKAEPKSPRDALKVGGPSAE
C
PFDLTTKPKEAKPALLAPKVPLIPSSGEEQPLDLSIGSRARASQNGGGREPRKNHVYGERKPGVSEGLP
K
VCPAQLPQQPSLHYAKPSPFFMDPIY
RVEKRKVADPVGVLKEKYLRPSPLLFHPQMSAIETMTEKLESF
A
AMKADSGSSLQPLPHHPFNFRSPPPTLSDPILRKGKERYTC
RYCGKIFPRSANLTRHLRTHTGEQPYRC
K
YCDRSFSISSNLQRHVRNIHNKEKPFKCHLCNRCFGQQTNLDRHLKKHEHEGAP
VSQHSGVLTNHLGTS
A
SSPTSESDNHALLDEKEDSYFSEIRNFIANSEMNQASTRMDK
RPEIQDLDSNPPCPGSASAKPEDVEEE
E
EEELEEEDDDSLAGKSQEDTVSPTPEPQGVYEDEEDEEPPSLTMGFDHTR
RCVEERGGGLLALEPTPTF
G
KGLDLRRAAEEAFEVKDVLNSTLDSEVLKQTLYRQAKNQ
AYAMMLSLSEDTPLHAPSQSSLDAWLNITG
P
SSESGAFNPINHL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser