NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS71082.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
71082.1 Public Mus musculus 2 Nckap1 21 106 86 CCDS HistoryNCBI Gene:50884Re-query CCDS DB by CCDS ID:71082.1Re-query CCDS DB by GeneID:50884See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 16, NCBI annotation release 104, Ensembl annotation release 75

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 71082.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000111760 ENSMUSP00000107390 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000111760Link to Ensembl Protein Viewer:ENSMUSP00000107390Re-query CCDS DB by Nucleotide ID:ENSMUST00000111760Re-query CCDS DB by Protein ID:ENSMUSP00000107390
Original member Current member EBI,WTSI OTTMUST00000032325 OTTMUSP00000014352 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000032325Link to Vega Protein Viewer:OTTMUSP00000014352Re-query CCDS DB by Nucleotide ID:OTTMUST00000032325Re-query CCDS DB by Protein ID:OTTMUSP00000014352
Original member Current member NCBI NM_001290745.1 NP_001277674.1 Accepted alive Link to Nucleotide Sequence:NM_001290745.1Link to Protein Sequence:NP_001277674.1Re-query CCDS DB by Nucleotide ID:NM_001290745Re-query CCDS DB by Protein ID:NP_001277674Link to BLAST:NP_001277674.1

Chromosomal Locations for CCDS 71082.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 80501295 80501411 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 80502225 80502314 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 80506173 80506282 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 80506821 80506937 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 80508712 80508805 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 80512677 80512757 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 80513114 80513196 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 80517895 80517988 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 80519559 80519656 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 80519839 80519969 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 80520372 80520590 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 80523376 80523507 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 80524538 80524677 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 80525559 80525678 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 80528535 80528667 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 80530158 80530303 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 80533645 80533703 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 80535474 80535555 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 80538104 80538236 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 80540119 80540225 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 80540510 80540606 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 80541463 80541519 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 80544990 80545146 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 80547901 80547949 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 80548830 80548967 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 80553137 80553227 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 80553307 80553449 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 80554202 80554258 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 80554698 80554790 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 80570119 80570229 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 80571213 80571230 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 80580858 80580965 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3405 nt):
ATGTCGCGCTCCGTGCTGCAGCCCAGTCAGCAGAAGCTGGCGGAGAAGCTCACCATCCTCAACGACCGGG
GC
GTCGGCATGCTCACGCGCCTCTACAACATCAAGAAGCAAGGACAAGTTTGGAAGGCATGTGGCGACCC
C
AAGGCTAAACCCTCCTACCTTATTGACAAAAACCTGGAATCTGCTGTGAAATTCATAGTCAGAAAATTT
CCT
GCTGTAGAAACGCGCAACAACAATCAACAGCTGGCACAGCTACAGAAAGAAAAATCAGAGATTCTGA
AA
AATCTGGCGTTGTATTACTTTACATTTGTAGATGTTATGGAATTTAAGGACCATGTCTGTGACTTGCT
G
AATACTATTGACGTTTGCCAAGTCTTCTTTGATATTACTGTGAACTTTGATTTAACAAAGAACTACTTA
GAC
TTGACTGTAACCTATACAACATTAATGATACTGCTGTCCCGGATTGAAGAACGGAAGGCAATCATTG
GA
CTATACAATTATGCACATGAAATGACCCATGGAGCAAGTGACCGAGAATATCCACGCCTTGGTCAGAT
G
ATTGTGGACTATGAAAACCCTTTAAAAAAGATGATGGAAGAATTTGTACCCCATAGCAAGTCTCTTTCA
GAT
GCGCTAATTTCTCTTCAGATGGTGTATCCTAGACGGAACCTTTCAGCAGACCAGTGGAGGAATGCCC
AG
TTGCTGAGTCTCATCAGTGCACCCAGCACAATGCTTAATCCTGCGCAGTCGGACACTATGCCTTGTGA
A
TATCTCTCCTTGGATGCAATGGAGAAATGGATCATCTTTGGCTTTATTCTGTGCCATGGGATGCTAAAT
ACG
GAGGCTACCGCACTGAACCTTTGGAAGCTAGCTCTTCAGAGTAGCTCTTGCCTCTCTCTCTTTCGGG
AT
GAAGTTTTCCACATTCACAAAGCTGCAGAAGACTTATTTGTAAACATTCGGGGCTACAATAAACGTAT
T
AACGACATAAGAGAATGCAAGGAGGCGGCTGTATCCCACGCCGGCTCAATGCACAGAGAAAGACGCAAG
TTT
TTACGGTCTGCACTAAAAGAACTGGCCACTGTCCTCTCTGACCAGCCTGGCCTGCTTGGTCCCAAGG
CA
CTTTTTGTTTTCATGGCGTTATCTTTTGCCCGTGATGAAATTATCTGGCTGCTCCGTCACGCGGACAA
C
ATGCCAAAGAAGAGTGCAGATGACTTTATAGATAAGCACATTGCTGAGCTAATATTTTACATGGAAGAG
CTT
AGAGCACATGTCAGGAAGTATGGGCCTGTCATGCAGAGGTACTACGTGCAATACCTCTCTGGCTTTG
AT
GCTGTTGTCCTCAATGAACTTGTGCAGAACCTGTCTGTTTGCCCTGAGGATGAATCGATCATCATGTC
C
TCTTTTGTGAACACCATGACCTCCCTAAGTGTGAAGCAAGTTGAAGATGGAGAAGTGTTTGATTTCAGA
GGG
ATGAGATTAGATTGGTTTAGGTTACAGGCGTACACTAGCGTCTCCAAAGCTTCACTTAGCCTTGCAG
AT
CACAGAGAACTTGGAAAGATGATGAACACAATCATATTCCATACAAAAATGGTAGATTCCTTGGTTGA
A
ATGTTGGTGGAAACATCCGATCTCTCCATATTTTGTTTTTACAGCCGTGCTTTTGAGAAGATGTTTCAG
CAG
TGCTTGGAGCTGCCCTCTCAGTCAAGATACTCCATTGCCTTTCCTCTGCTCTGCACTCACTTCATGA
GC
TGCACACATGAACTGTGTCCTGAAGAGCGCCATCATATAGGAGATCGTAGCCTTTCCCTGTGCAATAT
G
TTCCTGGATGAGATGGCCAAACAAGCTCGAAATCTCATCACCGATATTTGCACAGAACAGTGTACTCTT
AGT
GACCAGTTATTGCCGAAGCATTGTGCCAAAACCATCAGTCAAGCAGTGAATAAGAAGTCAAAAAAAC
AG
ACGGGCAAGAAAGGGGAACCTGAAAGGGAAAAACCGGGTGTGGAGAGCATGAGGAAAAACAGGCTGGT
A
GTGACCAACCTTGATAAGTTGCACACTGCACTTTCGGAGTTATGCTTCTCCATAAATTATGTTCCAAAC
ATG
GCGGTGTGGGAGCACACCTTCACGCCGAGGGAGTATTTGACTTCTCATCTGGAAATCCGGTTCACTA
A
A
TCAATTGTTGGAATGACTATGTATAATCAAGCTACACAGGAAATTGCAAAGCCATCAGAGCTTCTAAC
A
AGCGTAAGAGCATATATGACTGTACTCCAGTCCATAGAGAACTATGTGCAGATTGATATCACCAGAGTA
TTT
AATAATGTCCTTCTTCAGCAAACACAACACTTAGACAGCCATGGAGAACCAACCATCACGAGTCTGT
AT
ACAAACTGGTACTTGGAAACTTTATTAAGACAAGTCAGCAATGGCCATATAGCTTATTTTCCTGCAAT
G
AAAGCATTTGTGAATTTACCCACAGAAAATGAATTAACATTCAATGCAGAGGAATATTCTGATATATCA
G
AA
ATGAGATCATTATCAGAGCTCCTAGGCCCATATGGGATGAAGTTCCTGAGTGAGAGCCTTATGTGGC
AC
ATTTCATCACAAGTAGCTGAACTTAAGAAACTTGTGGTGGAGAATGTTGATGTTCTAACACAAATGAG
G
ACCAGCTTTGACAAACCAGACCAGATGGCTGCACTCTTTAAAAGATTATCATCTGTTGACAGTGTCTTG
AAA
AGGATGACGATAATTGGTGTTATTTTATCCTTCCGGTCATTGGCACAAGAAGCATTGAGAGATGTCC
TG
TCCTACCACATTCCTTTCCTCGTGAGCTCCATTGAAGATTTCAAGGATCACATTCCTCGGGAAACTGA
T
ATGAAGGTTGCAATGAATGTGTATGAGCTGTCCTCGGCTGCTGGGTTACCATGTGAGATTGATCCTGCC
TTA
GTCGTAGCTCTTTCCTCACAAAAATCAGAGAACATTAGTCCAGAGGAAGAATACAAGATCGCTTGTC
TC
CTGATGGTCTTTGTAGCAGTTTCCTTGCCTACACTGGCCAGCAATGTAATGTCACAGTACAGCCCTGC
A
ATAGAAGGACACTGCAACAATATACATTGTTTGGCCAAAGCCATCAACCAGATTGCTGCAGCTTTGTTT
ACA
ATTCACAAAGGAAGTATTGAAGACCGACTTAAGGAATTCCTGGCGCTTGCATCATCCAGTCTACTGA
AA
ATTGGCCAAGAGACAGATAAAACTACAACAAGAAATAGAGAATCTGTTTATTTGCTACTGGATATGAT
T
GTACAAGAATCACCATTCCTGACAATGGATCTCTTGGAATCTTGTTTTCCTTATGTGTTGCTGAGAAAT
GCA
TACCATGCTGTCTACAAACAAAGTGTTACATCTTCTGCATAG


Translation (1134 aa):
MSRSVLQPSQQKLAEKLTILNDRGVGMLTRLYNIKKQGQVWKACGDPKAKPSYLIDKNLESAVKFIVRKF
P
AVETRNNN
QQLAQLQKEKSEILKNLALYYFTFVDVMEFKDHVCDLLNTIDVCQVFFDITVNFDLTKNYL
D
LTVTYTTLMILLSRIEERKAIIGLYNYAHEMTHGA
SDREYPRLGQMIVDYENPLKKMMEEFVPHSKSLS
D
ALISLQMVYPRRNLSADQWRNAQLLSLISAPSTMLNPAQSDT
MPCEYLSLDAMEKWIIFGFILCHGMLN
T
EATALNLWKLALQSSSCLSLFRDEVFHIHKAAEDLFVNIR
GYNKRINDIRECKEAAVSHAGSMHRERRK
F
LRSALKELATVLSDQPGLLGPK
ALFVFMALSFARDEIIWLLRHADNMPKKSADDFIDKHIAELIFYMEE
L
RAHVRKYGPVMQRYYVQYLSGFDAVVLNELVQ
NLSVCPEDESIIMSSFVNTMTSLSVKQVEDGEVFDFR
G
MRLDWFRLQ
AYTSVSKASLSLADHRELGKMMNTIIFHTKMVDSLVEMLVETSDLSIFCFYSRAFEKMFQ
Q
CLELPSQSRYSIAFPLLCTHFMSCTHELCPEE
RHHIGDRSLSLCNMFLDEMAKQARNLITDICTEQCTL
S
DQ
LLPKHCAKTISQAVNKKSKKQTGKKGEPEREKPGVESMRKNRLVVTNLDKLHTALSELCFSINYVPN
M
AVWEHTFTPREYLTSHLEIRFT
KSIVGMTMYNQATQEIAKPSELLTSVRAYMTVLQSIENYVQIDITRV
F
NNVLLQQTQHLDSHGEPTITSLYTN
WYLETLLRQVSNGHIAYFPAMKAFVNLPTENELTFNAEEYSDIS
E
MRSLSELLGPYGMKFLSESLMWHISSQVAELKKLVVENVDVLTQMRTSFDKPDQMAALFKRLSSVDSVL
K
RMTIIGVILSFRSLAQEALRD
VLSYHIPFLVSSIEDFKDHIPRETDMKVAMNVYELSSAAGLPCEIDPA
L
VVALSSQKS
ENISPEEEYKIACLLMVFVAVSLPTLASNVMSQYSPAIEGHCNNIHCLAKAINQIAAALF
T
IHKGSIEDRLKEFLA
LASSSLLKIGQETDKTTTRNRESVYLLLDMIVQESPFLTMDLLESCFPYVLLRN
A
YHAVYKQSVTSSA




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser