NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS70677.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
70677.1 Public Mus musculus 16 Nlrc3 21 106 86 CCDS HistoryNCBI Gene:268857Re-query CCDS DB by CCDS ID:70677.1Re-query CCDS DB by GeneID:268857See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 16, NCBI annotation release 104, Ensembl annotation release 75

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 70677.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000180200 ENSMUSP00000137325 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000180200Link to Ensembl Protein Viewer:ENSMUSP00000137325Re-query CCDS DB by Nucleotide ID:ENSMUST00000180200Re-query CCDS DB by Protein ID:ENSMUSP00000137325
Original member Current member EBI,WTSI OTTMUST00000111445 OTTMUSP00000062394 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000111445Link to Vega Protein Viewer:OTTMUSP00000062394Re-query CCDS DB by Nucleotide ID:OTTMUST00000111445Re-query CCDS DB by Protein ID:OTTMUSP00000062394
Original member NCBI NM_175547.3 NP_780756.1 Updated not alive Link to Nucleotide Sequence:NM_175547.3Link to Protein Sequence:NP_780756.1Re-query CCDS DB by Nucleotide ID:NM_175547Re-query CCDS DB by Protein ID:NP_780756
Current member NCBI NM_175547.4 NP_780756.1 Accepted alive Link to Nucleotide Sequence:NM_175547.4Link to Protein Sequence:NP_780756.1Re-query CCDS DB by Nucleotide ID:NM_175547Re-query CCDS DB by Protein ID:NP_780756Link to BLAST:NP_780756.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_780756.1 397 Q5DU56-3 397 100% 0 0

Chromosomal Locations for CCDS 70677.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 16 (NC_000082.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 3947449 3947539 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 3947826 3947909 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 3948260 3948343 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 3948904 3948987 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 3949370 3949453 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 3952387 3952470 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 3952863 3952946 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 3953428 3953511 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 3953932 3954015 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 3954556 3954639 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 3955145 3955228 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 3957269 3957352 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 3958930 3959013 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 3959391 3959474 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 3976329 3976339 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1194 nt):
ATGGCAGGAAGCCTGGCTGAGAATCAGATTGGTAACAAAGGAGCCAAAGCCCTGGCCAGATCCCTCCTGG
TT
AACAGAAGCCTCATCACACTGGACCTCCGGAGTAACAGCATTGGACCACCGGGGGCTAAGGCTTTGGC
C
GATGCTCTGAAGATAAACCGAACGCTAACTTCTCTAAGCCTCCAAAGCAACGTGATCAAGGATGACGGT
GTC
ATGTGCGTGGCTGAGGCCCTGGTCTCCAACCAGACCATCTCCATGCTACAGCTACAGAAGAACTTAA
TT
GGGCTCATAGGAGCCCAGCAGATGGCAGATGCCCTGAAGCAGAACAGGAGCCTGAAAGCACTCATGTT
T
TCCAGTAATACCATTGGCGACAGAGGTGCCATAGCCCTGGCTGAGGCCCTGAAGGTGAACCAGATCCTG
GAG
AACTTAGACCTACAGAGCAATTCCATCAGTGACATGGGAGTGACGGTGCTGATGCGAGCCCTCTGCA
GT
AACCAGACACTCTCCAGTCTCAACCTGCGAGAAAACTCCATCAGCCCAGAGGGAGCCCAGGCCCTCAC
T
CAAGCTCTCTGCAGGAACAACACTCTGAAGCACTTGGACCTGACAGCTAATCTCCTCCATGACCGAGGT
GCC
CAGGCCATTGCAGTAGCTGTGGGAGAAAACCACTCCCTCACACACCTTCACCTGCAGTGGAACTTCA
TC
CAAGCTGGTGCGGCCAGGGCCCTGGGACAAGCACTCCAGCTGAACAGAACCCTGACAACCTTAGACTT
A
CAGGAGAATGCCATAGGGGATGAAGGAGCTTCCTCAGTGGCTGGCGCACTGAAGGTGAACACAACCCTC
ATT
GCTCTCTACCTACAGGTGGCCTCCATTGGTAGCCAAGGGGCCCAGGCACTTGGGGAGGCCCTCACTG
TG
AACAGAACCTTGGAGATTCTTGACTTACGAGGAAACGACGTTGGGGCAGCTGGAGCCAAGGCCTTGGC
A
AATGCTTTAAAGTTAAACTCCAGTCTCCGAAGACTCAATCTCCAGGAGAACTCACTGGGGATGGATGGG
GCC
ATATTTGTTGCCTCTGCACTGTCTGAGAACCACGGTCTGCACCATATTAATCTCCAGGGGAATCCCA
TT
GGGGAGTCTGCTGCCAGGATGATCTCAGAGGCCATCAAGACAAACGCTCCCACATGCACTGTGGAAAT
A
TAA


Translation (397 aa):
MAGSLAENQIGNKGAKALARSLLVNRSLITLDLRSNSIGPPGAKALADALKINRTLTSLSLQSNVIKDDG
V
MCVAEALVSNQTISML
QLQKNLIGLIGAQQMADALKQNRSLKALMFSSNTIGDRGAIALAEALKVNQIL
E
NL
DLQSNSISDMGVTVLMRALCSNQTLSSLNLRENSISPEGAQALTQALCRNNTLKHLDLTANLLHDRG
A
QAIAVAVGENHSLTHL
HLQWNFIQAGAARALGQALQLNRTLTTLDLQENAIGDEGASSVAGALKVNTTL
I
AL
YLQVASIGSQGAQALGEALTVNRTLEILDLRGNDVGAAGAKALANALKLNSSLRRLNLQENSLGMDG
A
IFVASALSENHGLHHI
NLQGNPIGESAARMISEAIKTNAPTCTVEI



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser