NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS70268.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
70268.1 Public Mus musculus 11 Rad51d 21 106 86 CCDS HistoryNCBI Gene:19364Re-query CCDS DB by CCDS ID:70268.1Re-query CCDS DB by GeneID:19364See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 16, NCBI annotation release 104, Ensembl annotation release 75

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 70268.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000021033 ENSMUSP00000021033 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000021033Link to Ensembl Protein Viewer:ENSMUSP00000021033Re-query CCDS DB by Nucleotide ID:ENSMUST00000021033Re-query CCDS DB by Protein ID:ENSMUSP00000021033
Original member Current member EBI,WTSI OTTMUST00000077108 OTTMUSP00000040691 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000077108Link to Vega Protein Viewer:OTTMUSP00000040691Re-query CCDS DB by Nucleotide ID:OTTMUST00000077108Re-query CCDS DB by Protein ID:OTTMUSP00000040691
Original member Current member NCBI NM_001277942.1 NP_001264871.1 Accepted alive Link to Nucleotide Sequence:NM_001277942.1Link to Protein Sequence:NP_001264871.1Re-query CCDS DB by Nucleotide ID:NM_001277942Re-query CCDS DB by Protein ID:NP_001264871Link to BLink:NP_001264871.1

Chromosomal Locations for CCDS 70268.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 11Link to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 82878940 82879023 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 82879185 82879352 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 82882887 82882982 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 82883493 82883627 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 82883883 82883964 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 82889692 82889810 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 82889970 82890031 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 82890338 82890419 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (828 nt):
ATGGGCATGCTCAGGGCAGGGCTGTGCCCGGGCCTCACCGAGGAGACCGTCCAGCTTCTCAGAGGCCGAA
AG
ATAAAAACAGTGGCAGACCTGGCAGCTGCTGACTTGGAGGAAGTAGCCCAGAAGTGTGGCTTGTCCTA
C
AAGGCCCTCGTTGCCCTGAGGAGGGTGTTGCTGGCGCAGTTCTCGGCTTTCCCCTTAAATGGCGCAGAT
CTC
TATGAGGAACTGAAGACTTCCACGGCCATCCTGTCCACCGGCATCGGAAGCCTGGACAAACTACTTG
AT
GCTGGCCTCTATACTGGGGAGGTGACTGAAATTGTGGGTGGCCCAGGTAGCGGCAAAACCCAGGTGTG
T
CTCTGTGTGGCTGCAAATGTGGCCCATAGCCTGCAGCAGAATGTACTGTATGTGGATTCCAATGGAGGA
ATG
ACGGCGTCCCGCCTCCTCCAGCTACTACAGGCTAGAACCCAAGATGAGGAGAAACAGGCAAGTGCTC
TC
CAGAGGATACAGGTGGTGCGTTCATTTGACATCTTCCGGATGCTAGATATGCTACAGGACCTTCGCGG
C
ACCATAGCCCAGCAGGTGACCAACCACTTGACTCGAGATTGGGATGGTAGAAGATTCAAACCTGCCCTT
GGA
CGCTCCTGGAGCTTTGTGCCCAGTACCCGGATTCTCCTGGATGTCACTGAGGGGGCTGGGACACTCG
GT
AGCAGCCAACGCACAGTATGTCTGACCAAGTCTCCCCGCCAGCCAACGGGTCTGCAGGAGATGATAGA
C
ATTGGGACATTGGGGACTGAGGAGCAGAGCCCAGAATTACCTGGCAAGCAGACGTGA


Translation (275 aa):
MGMLRAGLCPGLTEETVQLLRGRKIKTVADLAAADLEEVAQKCGLSYKALVALRRVLLAQFSAFPLNGAD
L
YEELKTSTAILSTGIG
SLDKLLDAGLYTGEVTEIVGGPGSGKTQVCLCVAANVAHSLQQNVLYVDSNGG
M
TASRLLQLLQARTQDEEKQ
ASALQRIQVVRSFDIFRMLDMLQDLRGTIAQQVTNHLTRDWDGRRFKPAL
G
RSWSFVPSTRILLDVTEGAGTLGSSQRTVCLTKSPRQ
PTGLQEMIDIGTLGTEEQSPELPGKQT



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser