NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS70197.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
70197.1 Public Mus musculus 11 Zkscan17 21 106 86 CCDS HistoryNCBI Gene:268417Re-query CCDS DB by CCDS ID:70197.1Re-query CCDS DB by GeneID:268417See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 16, NCBI annotation release 104, Ensembl annotation release 75

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 70197.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000101150 ENSMUSP00000098709 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000101150Link to Ensembl Protein Viewer:ENSMUSP00000098709Re-query CCDS DB by Nucleotide ID:ENSMUST00000101150Re-query CCDS DB by Protein ID:ENSMUSP00000098709
Original member Current member EBI,WTSI OTTMUST00000012828 OTTMUSP00000005965 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000012828Link to Vega Protein Viewer:OTTMUSP00000005965Re-query CCDS DB by Nucleotide ID:OTTMUST00000012828Re-query CCDS DB by Protein ID:OTTMUSP00000005965
Original member Current member NCBI NM_001291014.1 NP_001277943.1 Accepted alive Link to Nucleotide Sequence:NM_001291014.1Link to Protein Sequence:NP_001277943.1Re-query CCDS DB by Nucleotide ID:NM_001291014Re-query CCDS DB by Protein ID:NP_001277943Link to BLAST:NP_001277943.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001277943.1 429 Q5SXI5-3 429 100% 0 0

Chromosomal Locations for CCDS 70197.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 59487066 59487817 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 59492115 59492228 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 59493171 59493281 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 59493715 59493847 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 59499544 59499620 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 59502920 59503022 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1290 nt):
ATGTCAGCAGAGTCCCAGAGCTACCCTGATGCCCCGCCTGGGGCTCTAGTACAGGGCACTGGGCTTCTAA
GC
AGATCACCAGGCCAGCCTAGCGAAGACTTAGTTCCGCAAGATGCGTTCGTTGTGCAGGAGCAGAGCAT
C
AGGGATGCCCAGCCCGTGGCCACCTGCCAGCTTCCCCCGAACCGAGTCTCCCCATTTAAGGACATGATT
TTA
TGCTTCTCAGAAGAGGACTGGTCCCTTCTGGACCCGGCACAGACTGGTTTCTATGGCGAATTCATCA
TT
GGGGAAGACTATGCAGTCTCCATGCCTCCAAATGAGCCTCCAGTTCAGCCAGGCCACTCCCATGAAGA
G
GAGAACGGGTTGCGGGTCACAGAGTGGACGACAGACCTCCAGGATAAAGAAATCCCCCAGGCCTCCTGC
TTA
GACCTTTCCAGCCTCCAGCCATTCCAAGGAGAAGAAAGAAGGAAGTGGGAGGAGCTGCAGGTGCCAG
AG
CTCCAGCCCTGCCCACAGGTGGTGCTCAGTCAGAGTCCCTGTCCAGCAGGAGGTGACCCGCCAGCCCT
C
AAGAGCAGTCTGGACCAGGAGGTGACCATCGAGATCGTGCTGTCCAGCTCTGGGGATGAGGACTCCCAG
CAC
AGCCCATACTGCACAGAGGAGCTGAGGAGCCCTCCAGAAGACCTGCACAGTGTCCCAGCCCACCAGA
GC
AACGCTAGTGCTGAGGGGGAGGTGCAAACCTCACAGAAATCTTACGTGTGCCCAAACTGTGGAAAGAT
C
TTCCGCTGGAGGGTCAACTTCATCCGGCACCTGCGCAGCCGCAGGGAGCAGAAGCCACACAAATGCTCA
GTG
TGCGGGGAGTTATTCAGTGACAGCGAGGACCTGGATGGTCACCTAGAGACCCACGAGGCCCAGAAGC
CC
TACAGGTGCACTGCCTGCGGGAAGAGCTTCCGCCTCAACTCACACCTCATCTCTCACCGCCGGATCCA
C
CTGCAGCCAGCCAGCCAGCAGCCCATGAAGAAGAGTGAGGAAGAAGCTCTGGAAACAGAGGGCACGGGT
GCC
AGCGACCTGCTGGAGAAGAGCAAAGCCAAGCTGAGCTTCCAGTGTGGGGACTGTGAGAAGAGCTTCC
AG
CGGCATGACCATCTGGTGAGACACCGTAGACACTGTCATCTAAAGGATGAGACCCGTCCCTTCCAGTG
T
CGGTACTGTGTCAAAACTTTCCGACAGAATTATGACCTCCTCCGCCATGAGCGCCTGCACATGAAGCGA
CGC
TCCAAGCAGGCTCTCAACTCATACTGA


Translation (429 aa):
MSAESQSYPDAPPGALVQGTGLLSRSPGQPSEDLVPQDAFVVQEQSIRDAQPVATCQLPPNRVSPFKDMI
L
CFSEEDWSLLDPAQTGFYGEFIIGEDYAVSMPP
NEPPVQPGHSHEEENGLRVTEWTTDLQDKEIPQASC
L
DLSSLQPFQGEERRKWEELQVPELQPCPQVVLSQSPCPAGGDPPALKSSLDQEVTIEIVLSSSGDEDSQ
H
SPYCTEELRSPPEDLHSVPAHQSNASAEGEVQTSQKSYVCPNCGKIFRWRVNFIRHLRSRREQKPHKCS
V
CGELFSDSEDLDGHLETHEAQKPYRCTACGKSFRLNSHLISHRRIHLQPASQQPMKKSEEEALETEGTG
A
SDLLEKSKAKLSFQCGDCEKSFQRHDHLVRHRRHCHLKDETRPFQCRYCVKTFRQNYDLLRHERLHMKR
R
SKQALNSY




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser