NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS70147.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
70147.1 Public Mus musculus 11 Vps54 21 106 86 CCDS HistoryNCBI Gene:245944Re-query CCDS DB by CCDS ID:70147.1Re-query CCDS DB by GeneID:245944See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 16, NCBI annotation release 104, Ensembl annotation release 75

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 70147.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000109578 ENSMUSP00000105206 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000109578Link to Ensembl Protein Viewer:ENSMUSP00000105206Re-query CCDS DB by Nucleotide ID:ENSMUST00000109578Re-query CCDS DB by Protein ID:ENSMUSP00000105206
Original member Current member EBI,WTSI OTTMUST00000011689 OTTMUSP00000005422 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000011689Link to Vega Protein Viewer:OTTMUSP00000005422Re-query CCDS DB by Nucleotide ID:OTTMUST00000011689Re-query CCDS DB by Protein ID:OTTMUSP00000005422
Original member Current member NCBI NM_001290628.1 NP_001277557.1 Accepted alive Link to Nucleotide Sequence:NM_001290628.1Link to Protein Sequence:NP_001277557.1Re-query CCDS DB by Nucleotide ID:NM_001290628Re-query CCDS DB by Protein ID:NP_001277557Link to BLink:NP_001277557.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001277557.1 965 Q5SPW0-2 965 100% 0 0

Chromosomal Locations for CCDS 70147.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 11Link to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 21263219 21263354 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 21264666 21264871 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 21268785 21268863 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 21271704 21271738 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 21274998 21275129 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 21277675 21278060 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 21291033 21291159 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 21292024 21292131 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 21295341 21295396 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 21298754 21298850 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 21299978 21300318 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 21305651 21305780 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 21306366 21306547 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 21306909 21307021 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 21308739 21308802 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 21311077 21311182 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 21312240 21312327 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 21312851 21312972 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 21313084 21313164 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 21314919 21315026 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 21316792 21316886 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 21319753 21319858 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2898 nt):
ATGGCTTCAAGCCACAGTTCTTCTCCAGTGCCTCAAGGAAGCAGCAGTGATGTTTTCTTTAAAAAAGAGG
TA
GATCCAACAAAACACATTCGACCTGTGCAGTCACTGCCAGATGTGTGTCCCAAGGAACCCACAGTTAC
A
GATCAACATAGATGGACTGTGTATCATTCCAAAGTAAATCTCCCAGCAGCATTAAATGATCCTACACTA
GCA
AAAAGAGAATCTGACTTCTTCACAAAAACTTGGGGATTGGACTTTGTGGACACTGAAGTCATACCTT
CA
CTCTACCTCCCACAGATCAGCAAGGAGAATTTTATAGCATATCAGCAGGAGATCTCTCAGAGAGAGAA
G
ATTCATGAGAGATGCAAGAATATTTGTCCTCCTAAAGATACCTTTGACAGGACTCTTTTACATATTCAT
G
AT
AAATCCAGGACAGATCTGGAGCAAGTACCTAAGATTTTTATGAAACCAGATTTTGCCTTGGATGATT
CT
TTAACTTTTAATTCAGTTTTACCATGGTCTCATTTTAATACTGCTGGTGGGAAAGGAAGTCGCGACGC
A
GCTTCTTCCAAGTTGCTTCAGGAAAAGCTGAGCCATTATCTGGATATTGTGGAAGTAAACATTGCTCAC
CAG
ATCTCTCTACGTTCAGAAGCATTTTTTCATGCAATGACCTCTCAACACGAATTGCAGGACTACCTCA
AG
AAAACTACCCAGGCTGTAAAAATGCTTCGAGATAAAATTGCACAGATTGATAAAGTTATGTGTGAAGG
A
TCACTACAGATTTTAAGACTGGCACTTACCAGAAATAATTGTGTTAAAGTATACAATAAACTGAAGTTA
ATG
GCCACTGTACACCAAACTCAGCCTACAGTGCAGGTGTTGTTATCTACTTCTGAATTTGTTGGAGCGT
TG
GACTTAATAGCAACAACTCAAGAGGTTCTGCAGCAGGAGCTTCAGGGCATTCACAGCTTCCGGCATTT
G
GGATCACAGCTTTGTGAATTAGAAAAGCTGATTGATAAAATGATGATTGCAGAATTTTCTACTTATTCT
CAT
AGTGACTTAAATAGACCACTGGAAGGTGAATGCCAAGTTTTAGAAGAGGAAAGATTAGTATCTCTTG
TA
TTTGGGCTTTTGAAACAAAGAAAACTTAATTTTTTAGAAATCTATGGTGAAGAAATGATTATTACAGC
A
AAGAACATCATTAAAGAGCGTGTGATTAATAAAGTTTCACAAATAGAAGAAATAGACACAGACGTTGTT
GTA
AAGCTTGCAGATCAAATGAGAATGTTGAATTTTCCCCAGTGGATTGATCTGTTAAAGGACATTTTCT
CT
AAGTTTACAGTTTTCCTACAGAGAGTTAAGGCAACATTGAATATTATCCACAGTGTTGTTCTGTCAGT
T
CTTGAGAAAAGCCAAAGGACTAGAGAATTGGAAGAGATCCCACAGCAGAGGAGCGCTGGGAAGGACAGC
TCC
TTGGACACAGACGTGGCTTACCTGACACACGAGGGCTGGTTCATAAGTGATGCTTTCAGTGAGGGTG
AG
CCAGCATCTGCGGCGGTTGATACTACCTCTCAAAGAAACACGTCTCCACATAGCGAGCCCTGCAGCAG
T
GATTCGGTATCAGAACCAGAATGTACTACTGATTCTTCATCCAGCAAGGAGCAGACATCAGCGTGTGCT
CCT
CCAGGAGGTATAGAGATTATAGTCAGTGAAGACATGAGGTTAACTGACTTGGAGCTAGGAAAACTAG
CA
AGTAACATCCAGGAGTTACTGTGTAATGCTTCAGATGTATGCCATGATCGAGCTGTCAAATTTCTCAT
G
TCAAGAGCAAAGGACGGTTTTCTTGAAAAATTGAATTCCACGGAATTCATAGCACTCTCGAGATTAATG
GAG
ACATTCATAGTGGACACTGAACAGATCTGTGGGAGGAAGAGCACGTCACTGCTTGGGGCCCTTCAGA
GC
CAAGCAAATAAGTTTGTGAACAGGTTTCATGAAGAGAGGCGGACCAAGCTCAGCCTCCTCTTAGACAA
C
GAGCGTTGGAAGCAGGCTGATGTTCCTGCAGAATTTCAGGATCTTGTTGATTCTATAGCGGATGGAAAG
ATT
GCTTTACCTGAAAAAAAGCCAGTGGTTACAGAAGAAAGGAAGCCAGCTGATGTTCTTGTTGTTGAGG
GA
CACCAGTATGCAGTTGTCGGAACCGTCTTGCTGTTAATAAGAATCATTCTTGAATATTGCCAGTGTGT
G
GATAACATCCCCTCCGTCACTACTGACATGCTCACTCGCCTGACAGATCTGCTGAAGTACTTCAATTCA
AGA
AGTTGCCAGTTAGTTCTTGGAGCTGGTGCTTTGCAAGTTGTTGGACTAAAAACAATTACTACAAAAA
AC
TTGGCCCTCTCTTCACGGTGTCTGCAGTTGATTGTGCACTACATTCCCGTGATCCGGGCTCACTTTGA
A
GCCCGACTGCCCCCCAAGCAATGGAGCATGCTTAGACATTTTGATCACATCACAAAGGATTACCATGAT
CAT
ATAGCTGAAATTTCAGCTAAGCTTGTAGCGATAATGGATAGCCTATTTGATAAGCTGTTATCAAAGT
AT
GAGGTGAAAGCTCCTGTTCCTTCCCCGTGTTTCAGGAATATTTGTAAGCAAATGACAAAAATGCATGA
A
GCTATATTTGATCTTCTTCCCGAAGAACAAACACAGATGTTATTTTTAAGAATTAATGCAAGTTACAAA
CTC
CACTTGAAAAAACAGTTATCACACTTAAATGTAATAAATGACGGAGGACCTCAAAATGGGTTGGTCA
CA
GCAGATGTAGCTTTTTACACTGGAAATCTTCAAGCCTTAAAAGGCCTTAAAGATCTGGATCTAAATAT
G
GCCGAGATCTGGGAACAGAAGAGGTGA


Translation (965 aa):
MASSHSSSPVPQGSSSDVFFKKEVDPTKHIRPVQSLPDVCPKEPTVTDQHRWTVYHSKVNLPAALNDPTL
A
KRESDFFTKTWGLDFVDTEVIPSLYLPQISKENFIAYQQEISQ
REKIHERCKNICPPKDTFDRTLLHIH
D
KSRTDLEQVPKIFMKPDFALDDSLTFNSVLPWSHFNTAGGKGSRDAASSKLLQEKLSHYLDIVEVNIAH
Q
ISLRSEAFFHAMTSQHELQDYLKKTTQAVKMLRDKIAQIDKVMCEGSLQILRLALTRNNCVKVYNKLKL
M
ATVHQTQPTVQVLLSTSEFVGALDLIATTQEVLQQELQGIHSF
RHLGSQLCELEKLIDKMMIAEFSTYS
H
SDLNRPLEGECQVLEE
ERLVSLVFGLLKQRKLNFLEIYGEEMIITAKNIIKERVINKVSQIEEIDTDVV
V
KLADQMRMLNFPQWIDLLKDIFSKFTVFLQRVKATLNIIHSVVLSVLEKSQRTRELEEIPQQRSAGKDS
S
LDTDVAYLTHEGWFISDAFSEGEPASAAVDTTSQRNTSPHSEPCSSDSVSEPECTTDSSSSKEQTSACA
P
PGGIEI
IVSEDMRLTDLELGKLASNIQELLCNASDVCHDRAVKFLMSRAKDGFLEKLNSTEFIALSRLM
E
TFIVDTEQICGRKSTSLLGALQSQANKFVNRFHEERRTKL
SLLLDNERWKQADVPAEFQDLVDSIADGK
I
ALPEKKPV
VTEERKPADVLVVEGHQYAVVGTVLLLIRIILEYCQCVDNIPSVTTDMLTRLTDLLKYFNS
R
SCQLVLGAGALQVVGLKTITTKNL
ALSSRCLQLIVHYIPVIRAHFEARLPPKQWSMLRHFDHITKDYHD
H
IAEISAKLVAIMDSLFDKLLSK
YEVKAPVPSPCFRNICKQMTKMHEAIFDLLPEEQTQMLFLRINASYK
L
HLKKQLSHLNVINDGGPQN
GLVTADVAFYTGNLQALKGLKDLDLNMAEIWEQKR



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser