NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS69896.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
69896.1 Public Mus musculus 1 D630023F18Rik 21 106 86 CCDS HistoryNCBI Gene:98303Re-query CCDS DB by CCDS ID:69896.1Re-query CCDS DB by GeneID:98303See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 16, NCBI annotation release 104, Ensembl annotation release 75

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 69896.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000148020 ENSMUSP00000120090 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000148020Link to Ensembl Protein Viewer:ENSMUSP00000120090Re-query CCDS DB by Nucleotide ID:ENSMUST00000148020Re-query CCDS DB by Protein ID:ENSMUSP00000120090
Original member Current member EBI,WTSI OTTMUST00000065889 OTTMUSP00000032896 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000065889Link to Vega Protein Viewer:OTTMUSP00000032896Re-query CCDS DB by Nucleotide ID:OTTMUST00000065889Re-query CCDS DB by Protein ID:OTTMUSP00000032896
Original member Current member NCBI NM_001285882.1 NP_001272811.1 Accepted alive Link to Nucleotide Sequence:NM_001285882.1Link to Protein Sequence:NP_001272811.1Re-query CCDS DB by Nucleotide ID:NM_001285882Re-query CCDS DB by Protein ID:NP_001272811Link to BLAST:NP_001272811.1

Chromosomal Locations for CCDS 69896.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 65105729 65105750 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 65109462 65109576 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 65109877 65109964 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 65116681 65116752 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 65117122 65117209 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 65119539 65119621 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 65121357 65121438 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 65123053 65123093 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (591 nt):
ATGGAAAGGAGGCTTGTGAAGCAGGAGGTGAAAAGGCTGCTGGGAGAGTATATCGGAATCAGACTTCGGG
AA
AATGAATTTGATCCTAAAGGAAGAGGCCAACTCACCTTTCTAGATGATATGGCCCACTATGACTTGGC
C
ATCAGTGTTGCCAGTCAATGGCTAGATTGCTCAGAAAACTTAACTTGGCTCCAGTGGGAGAAAGTGAGA
GCA
CCACTTCATGTCAGACCTGCGTATCCAAACCGAAAAGAGCGAGAAGCAATGATCTTATCATCATACG
CT
GGAGTCTTAATGAACAGTATTCCAATTGAAGAAGTCCTTAAAATTTATGGGGCCAATTCTTCTGCCAG
T
CCTGATTCTACCAAGGTCGCCCAGGCCCTGCTGCCCCGCCGCTCCTTGCATCCTTTTGCCATGTTGACC
GCA
CCCAGAGCAGCAGAGTGCAACCGGAGACAGAGTGTCAAGTTGAGAAGAGGCGCAACGAATAAAAATA
CC
ACCAGCAGTTCTACAAAGAAAGCAACAGGGCAGAATGGAGATCCTGTCGGGAAAGGCACCCACACCCC
A
GCAACAAAGTCACTTAGAAACGTGGACTAG


Translation (196 aa):
MERRLVKQEVKRLLGEYIGIRLRENEFDPKGRGQLTFLDDMAHYDLAISVASQWLDCSENLTWLQWEKVR
A
PLHVRPAYPNRKEREAMILSSYAGVLM
NSIPIEEVLKIYGANSSASPDSTKVAQALLPRRSLHPFAMLT
A
PRAAECNRRQ
SVKLRRGATNKNTTSSSTKKATGQNGDPVGKGTHTPATKSLRNVD



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser