NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS57074.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
57074.1 Public Mus musculus 17 H2-D1 21 106 86 CCDS HistoryNCBI Gene:14964Re-query CCDS DB by CCDS ID:57074.1Re-query CCDS DB by GeneID:14964See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 10, NCBI annotation release 38.1, Ensembl annotation release 68

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 57074.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000172785 ENSMUSP00000134570 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000172785Link to Ensembl Protein Viewer:ENSMUSP00000134570Re-query CCDS DB by Nucleotide ID:ENSMUST00000172785Re-query CCDS DB by Protein ID:ENSMUSP00000134570
Original member Current member EBI,WTSI OTTMUST00000095494 OTTMUSP00000053284 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000095494Link to Vega Protein Viewer:OTTMUSP00000053284Re-query CCDS DB by Nucleotide ID:OTTMUST00000095494Re-query CCDS DB by Protein ID:OTTMUSP00000053284
Original member Current member NCBI NM_010380.3 NP_034510.3 Accepted alive Link to Nucleotide Sequence:NM_010380.3Link to Protein Sequence:NP_034510.3Re-query CCDS DB by Nucleotide ID:NM_010380Re-query CCDS DB by Protein ID:NP_034510Link to BLink:NP_034510.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_034510.3 362 P01899 362 100% 0 0

Chromosomal Locations for CCDS 57074.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 17 (NC_000083.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 17Link to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 35263114 35263186 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 35263379 35263648 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 35263839 35264114 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 35265784 35266059 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 35266187 35266303 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 35266482 35266514 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 35266688 35266726 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 35266866 35266870 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1089 nt):
ATGGGGGCGATGGCTCCGCGCACGCTGCTCCTGCTGCTGGCGGCCGCCCTGGCCCCGACTCAGACCCGCG
CG
GGCCCACACTCGATGCGGTATTTCGAGACCGCCGTGTCCCGGCCCGGCCTCGAGGAGCCCCGGTACAT
C
TCTGTCGGCTATGTGGACAACAAGGAGTTCGTGCGCTTCGACAGCGACGCGGAGAATCCGAGATATGAG
CCG
CGGGCGCCGTGGATGGAGCAGGAGGGGCCGGAGTATTGGGAGCGGGAAACACAGAAAGCCAAGGGCC
AA
GAGCAGTGGTTCCGAGTGAGCCTGAGGAACCTGCTCGGCTACTACAACCAGAGCGCGGGCGGCTCTCA
C
ACACTCCAGCAGATGTCTGGCTGTGACTTGGGGTCGGACTGGCGCCTCCTCCGCGGGTACCTGCAGTTC
GCC
TATGAAGGCCGCGATTACATCGCCCTGAACGAAGACCTGAAAACGTGGACGGCGGCGGACATGGCGG
CG
CAGATCACCCGACGCAAGTGGGAGCAGAGTGGTGCTGCAGAGCATTACAAGGCCTACCTGGAGGGCGA
G
TGCGTGGAGTGGCTCCACAGATACCTGAAGAACGGGAACGCGACGCTGCTGCGCACAGATTCCCCAAAG
GCA
CATGTGACCCATCACCCCAGATCTAAAGGTGAAGTCACCCTGAGGTGCTGGGCCCTGGGCTTCTACC
CT
GCTGACATCACCCTGACCTGGCAGTTGAATGGGGAGGAGCTGACCCAGGACATGGAGCTTGTGGAGAC
C
AGGCCTGCAGGGGATGGAACCTTCCAGAAGTGGGCATCTGTGGTGGTGCCTCTTGGGAAGGAGCAGAAT
TAC
ACATGCCGTGTGTACCATGAGGGGCTGCCTGAGCCCCTCACCCTGAGATGGGAGCCTCCTCCGTCCA
CT
GACTCTTACATGGTGATCGTTGCTGTTCTGGGTGTCCTTGGAGCTATGGCCATCATTGGAGCTGTGGT
G
GCTTTTGTGATGAAGAGAAGGAGAAACACAGGTGGAAAAGGAGGGGACTATGCTCTGGCTCCAGGCTCC
CAG
AGCTCTGAAATGTCTCTCCGAGATTGTAAAGCGTGA


Translation (362 aa):
MGAMAPRTLLLLLAAALAPTQTRAGPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYE
P
RAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAG
GSHTLQQMSGCDLGSDWRLLRGYLQF
A
YEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRT
DSPK
A
HVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQN
Y
TCRVYHEGLPEPLTLRW
EPPPSTDSYMVIVAVLGVLGAMAIIGAVVAFVMKRRRNTGGKGGDYALAPGS
Q
SSEMSLRDCK
A



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser