NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS56790.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
56790.1 Public Mus musculus 11 Rpain 21 106 86 CCDS HistoryNCBI Gene:69723Re-query CCDS DB by CCDS ID:56790.1Re-query CCDS DB by GeneID:69723See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 10, NCBI annotation release 38.1, Ensembl annotation release 68

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 56790.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000178822 ENSMUSP00000136592 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000178822Link to Ensembl Protein Viewer:ENSMUSP00000136592Re-query CCDS DB by Nucleotide ID:ENSMUST00000178822Re-query CCDS DB by Protein ID:ENSMUSP00000136592
Original member Current member EBI,WTSI OTTMUST00000111376 OTTMUSP00000062333 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000111376Link to Vega Protein Viewer:OTTMUSP00000062333Re-query CCDS DB by Nucleotide ID:OTTMUST00000111376Re-query CCDS DB by Protein ID:OTTMUSP00000062333
Original member NCBI NM_001252415.1 NP_001239344.1 Updated not alive Link to Nucleotide Sequence:NM_001252415.1Link to Protein Sequence:NP_001239344.1Re-query CCDS DB by Nucleotide ID:NM_001252415Re-query CCDS DB by Protein ID:NP_001239344
Current member NCBI NM_001252415.2 NP_001239344.1 Accepted alive Link to Nucleotide Sequence:NM_001252415.2Link to Protein Sequence:NP_001239344.1Re-query CCDS DB by Nucleotide ID:NM_001252415Re-query CCDS DB by Protein ID:NP_001239344Link to BLAST:NP_001239344.1

Chromosomal Locations for CCDS 56790.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 70970507 70970587 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 70971764 70971934 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 70973015 70973075 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 70973802 70973913 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 70974069 70974132 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 70974994 70975029 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (525 nt):
ATGGCAGAGTCCTCGGGGTCTCCGCACCGCTTGTTGTACAAGCAGGTGGGCTCGCCCCACTGGAAAGAAA
CT
TTCAGGCAGGGATGTCTGGAGAGAATGAGAAACAGCAGGCACAGGCTCCTGAACAAATATCGCCAGGC
T
GCAGGTAGCACGCCGGGGACAGCCTCAGACAGACTTCTTGTGCAAGAAGTAATGGAGGAAGAGTGGGCT
TCT
TTGCAGTCTGTGGAGAATTGTCCGGAGGCCTTGCTTCAGTTGGAATTGCCACTGGACCTAGCTGTGC
TG
CAGGACATCGAGCAGGAGCTGTGTAATGAAGAAAAGTCCATCATAAGCGAGTATGAAGAGGACTTAGA
G
TTTGATGAAAGTTGTCTCAGGAGAATGTTGGCTGAGTGGGAAGCAAACTCCCTCATCTGTCCTGTGTGT
ATA
AAGTACAACCTGAGAATAATGAACAGTGTGGTCACGTGTCCATGTGGCCTGCACATCCCTGTTCACT
CA
CCGGTGGAACAGAAGAGAAGCCCAGTCTTCTGA


Translation (174 aa):
MAESSGSPHRLLYKQVGSPHWKETFRQGCLERMRNSRHRLLNKYRQAAGSTPGTASDRLLVQEVMEEEWA
S
LQSVENCPEALLQ
LELPLDLAVLQDIEQELCNEEKSIISEYEEDLEFDESCLRRMLAEWEANSLICPVC
I
KYNLRIMNSVVTCPCGLHIPVHSPVEQKRSPVF



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser