NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS56720.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
56720.1 Public Mus musculus 10 Pcdh15 21 106 86 CCDS HistoryNCBI Gene:11994Re-query CCDS DB by CCDS ID:56720.1Re-query CCDS DB by GeneID:11994See the combined annotation on chromosome 10 in Sequence Viewer

Public since: CCDS release 10, NCBI annotation release 38.1, Ensembl annotation release 68

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 56720.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000126920 ENSMUSP00000121939 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000126920Link to Ensembl Protein Viewer:ENSMUSP00000121939Re-query CCDS DB by Nucleotide ID:ENSMUST00000126920Re-query CCDS DB by Protein ID:ENSMUSP00000121939
Original member Current member EBI,WTSI OTTMUST00000104187 OTTMUSP00000058281 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000104187Link to Vega Protein Viewer:OTTMUSP00000058281Re-query CCDS DB by Nucleotide ID:OTTMUST00000104187Re-query CCDS DB by Protein ID:OTTMUSP00000058281
Original member Current member NCBI NM_001142739.1 NP_001136211.1 Accepted alive Link to Nucleotide Sequence:NM_001142739.1Link to Protein Sequence:NP_001136211.1Re-query CCDS DB by Nucleotide ID:NM_001142739Re-query CCDS DB by Protein ID:NP_001136211Link to BLink:NP_001136211.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001136211.1 1916 Q99PJ1-8 1916 100% 0 0

Chromosomal Locations for CCDS 56720.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 10 (NC_000076.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 10Link to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10See the combined annotation on chromosome 10 in Sequence Viewer

Chromosome Start Stop Links
10 73947056 73947146 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 74170449 74170609 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 74185274 74185429 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 74210367 74210486 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 74222360 74222470 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 74230210 74230380 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 74290967 74291075 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 74303094 74303206 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 74316963 74317169 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 74324358 74324492 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 74326055 74326204 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 74342503 74342696 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 74355858 74355990 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 74379333 74379412 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 74385867 74385960 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 74396351 74396479 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 74450156 74450461 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 74453877 74454101 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 74466282 74466398 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 74482037 74482177 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 74486208 74486320 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 74502686 74502795 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 74504668 74504808 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 74550457 74550584 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 74584013 74584228 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 74594160 74594248 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 74621199 74621375 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 74624205 74624423 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 74626147 74626155 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 74626687 74626842 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 74628928 74628933 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 74630511 74631954 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (5751 nt):
ATGTTCCTACAGTTTGCTGTCTGGAAGTGTTTACCCCATGGGATCCTCATTGCCTCTCTCTTGGTAGTCA
GC
TGGGGCCAGTATGACGATGGTACAATTCTGGTGGATAACATGTTGATTAAGGGGACTGCCGGAGGACC
A
GACCCCACCATAGAGCTCTCTTTAAAGGACAACGTGGACTACTGGGTGTTGCTGGACCCCGTTAAACAG
ATG
CTTTTCCTGAACAGTACCGGAAGAGTTCTGGATAGAGACCCACCAATGAACATACACTCCATTGTGG
TG
CAAGTCCAGTGTGTCAACAAGAAGGTTGGCACAGTTATCTATCATGAAGTACGCATCGTGGTGCGAGA
T
CGGAATGACAACTCCCCCACATTCAAGCATGAAAGCTACTATGCCACCGTGAATGAGCTCACTCCAGTT
GGC
ACCACGATATTCACGGGGTTCTCGGGAGACAATGGAGCTACAGACATAGACGATGGCCCTAATGGAC
AG
ATAGAATACGTGATTCAGTACAACCCAGAAGATCCGACATCCAACGACACCTTTGAAATTCCACTCAT
G
CTGACTGGCAACGTGGTACTGAGGAAAAGACTCAACTATGAGGATAAGACTCGCTACTATGTCATCATC
CAA
GCAAATGACCGTGCACAAAATCTGAATGAGAGGCGAACAACCACCACCACCCTCACAGTAGATGTTC
TA
GATGGAGATGACCTGGGACCTATGTTTCTGCCTTGTGTTCTTGTGCCAAACACACGTGACTGTCGTCC
A
CTCACCTACCAAGCTGCCATTCCTGAACTGAGGACTCCGGAAGAACTGAACCCTATTTTGGTGACACCA
CCT
ATCCAAGCCATTGATCAGGACCGAAACATCCAACCACCATCTGATCGACCTGGCATCCTCTACTCCA
TC
CTTGTCGGCACCCCTGAGGATTACCCCCGCTTCTTCCATATGCATCCCAGGACTGCAGAACTCACTCT
C
CTGGAGCCAGTAAACAGAGACTTCCATCAAAAATTTGATTTGGTTATTAAGGCTGAGCAGGACAATGGC
CAC
CCACTTCCTGCCTTTGCTAGTCTGCACATCGAAATACTAGACGAAAACAATCAGAGTCCATACTTCA
CA
ATGCCCAGCTATCAAGGATACATCCTGGAATCCGCCCCAGTGGGAGCCACCATTTCTGAGAGCCTAAA
C
TTAACCACTCCTCTGAGAATTGTAGCTCTGGACAAAGACATAGAAGACACAAAAGATCCAGAGCTCCAC
CTC
TTCCTGAATGACTACACCTCGGTCTTCACTGTGACACCCACTGGTATCACCCGCTACCTCACCCTGC
TT
CAACCTGTGGACAGGGAGGAACAGCAAACCTACACCTTTCTGATAACAGCGTTTGATGGCGTGCAAGA
A
AGTGAGCCAGTCGTGGTCAATATCCGAGTGATGGATGCAAATGATAACACGCCCACCTTCCCTGAAATC
TCC
TATGATGTCTATGTTTACACAGACATGAGTCCTGGGGACAGCGTCATTCAGCTGACAGCGGTAGATG
CT
GATGAAGGCTCTAATGGGGAGATCTCCTATGAAATACTGGTGGGGGGCAAGGGAGACTTCGTGATCAA
C
AAGACCACAGGGCTGGTGAGCATTGCACCAGGCGTGGAGCTGATCGTGGGACAGACGTATGCGCTCACA
GTG
CAGGCTTCGGACAACGCCCCGCCTGCAGAAAGAAGGCACTCCATCTGCACAGTGTACATCGAGGTGC
TT
CCTCCTAACAACCAGAGCCCTCCCCGCTTCCCGCAGCTGATGTACAGTCTGGAAGTCAGCGAGGCCAT
G
AGGATCGGTGCTATTTTATTAAATCTACAGGCAACTGATCGAGAGGGAGATCCAATCACATATGCCATC
GAG
AATGGAGACCCTCAGAGAGTTTTTAATCTTTCAGAAACCACAGGGATTCTCAGCCTAGGGAAGGCTC
TA
GACCGCGAGAGCACAGACCGCTACATCCTCATCGTCACAGCCTCAGATGGCAGACCGGATGGAACCTC
A
ACTGCCACTGTGAACATAGTGGTGACGGACGTCAATGACAACGCTCCCGTGTTCGATCCCTATCTGCCC
AGG
AACCTCTCTGTGGTGGAGGAAGAAGCCAATGCCTTTGTGGGTCAAGTCCGGGCAACAGACCCAGATG
CT
GGGATAAACGGCCAAGTTCACTACAGCCTGGGGAACTTCAACAACCTCTTCCGCATCACATCCAACGG
G
AGCATTTACACAGCCGTGAAGCTGAACAGGGAAGCCAGGGACCACTATGAACTGGTTGTCGTGGCAACA
GAT
GGAGCAGTCCACCCTCGACATTCAACTCTGACACTGTACATCAAGGTGTTGGACATTGATGATAACA
GT
CCTGTTTTTACCAATTCAACGTACACAGTTGTCGTTGAAGAGAATCTGCCAGCCGGGACCTCCTTTCT
T
CAAATAGAGGCCAAGGATGTTGACCTTGGAGCCAATGTGTCATATCGGATCAGAAGCCCAGAAGTGAAA
CAC
CTTTTTGCACTGCATCCATTCACTGGAGAATTGTCTCTTCTGAGGAGTTTGGATTATGAGGCCTTTC
CG
GACCAGGAGGCAAGCATCACATTCTTGGTGGAGGCCTTTGACATTTATGGGACTATGCCACCTGGTAT
A
GCAACAGTCACGGTAATTGTGAAGGACATGAATGACTACCCTCCAGTGTTTAGCAAACGCATCTACAAG
GGG
ATGGTGGCTCCAGATGCAGTCAAGGGGACACCAATCACCACCGTTTATGCTGAAGATGCGGACCCAC
CT
GGGATGCCTGCAAGTAGGGTGAGGTATCGAGTGGACGACGTGCAGTTTCCATACCCAGCCAGTATTTT
T
GATGTAGAGGAAGATTCTGGAAGAGTAGTAACCCGCGTCAATCTTAATGAAGAGCCTACTACGATTTTC
AAG
CTGGTGGTTGTGGCTTTTGATGACGGCGAACCTGTGATGTCCAGCAGTGCCACGGTGAGAATTCTTG
TC
TTACATCCTGGAGAGATCCCACGCTTCACCCAAGAGGAATACAGACCTCCTCCTGTAAGTGAGCTTGC
G
GCCAGAGGGACTGTAGTTGGTGTCATTTCTGCTGCTGCCATTAATCAGAGCATCGTGTACTCCATTGTG
GCA
GGAAATGAGGAAGACAAGTTTGGAATCAACAATGTCACTGGGGTCATCTATGTGAATTCACCATTGG
AT
TACGAGACAAGGACCAGCTATGTGCTCCGGGTACAAGCAGATTCTCTGGAAGTGGTCCTTGCCAATCT
C
CGAGTCCCTTCAAAAAGCAATACAGCTAAGGTGTACATTGAGATTCAGGATGAAAACGATCACCCCCCA
GTG
TTCCAGAAGAAATTCTACATTGGAGGTGTGTCTGAAGACGCAAGGATGTTCGCATCTGTGCTCAGAG
TG
AAGGCCACCGACAGGGACACGGGTAATTACAGTGCCATGGCCTACCGGCTCATCATACCGCCGATTAA
A
GAGGGCAAAGAGGGGTTTGTGGTGGAAACATACACAGGTCTCATCAAGACAGCCATGCTCTTCCACAAT
ATG
AGAAGATCCTACTTCAAGTTTCAAGTGATTGCAACTGACGACTACGGGAAGGGGTTGAGCGGGAAAG
CA
GACGTACTGGTCTCCGTGGTCAATCAACTGGATATGCAGGTCATTGTCTCCAATGTGCCCCCTACACT
A
GTGGAAAAGAAGATAGAAGACCTTACAGAGATTTTGGATCGCTACGTTCAGGAGCAAATTCCTGGTGCC
AAG
GTTGTGGTGGAGTCCATAGGTGCCCGTCGCCATGGAGACGCCTACTCCCTAGAAGACTATAGCAAGT
GC
GACCTGACTGTCTATGCCATCGACCCGCAGACCAACAGAGCCATCGACAGAAATGAGCTTTTTAAGTT
C
CTGGACGGCAAACTGCTCGATATCAATAAAGACTTCCAGCCGTATTACGGGGAAGGAGGGCGCATTCTG
GAG
ATTCGGACACCTGAGGCAGTGACGAGCATCAAGAAGCGAGGAGAAAGCTTGGGGTACACAGAAGGGG
CC
TTGCTGGCCTTGGCCTTCATCATCATCCTCTGTTGCATCCCAGCCATCTTGGTCGTCTTAGTAAGCTA
C
CGACAGTTTAAAGTACGCCAGGCTGAGTGCACGAAGACCGCAAGAATTCAGTCTGCTATGCCTGCAGCC
AAG
CCTGCAGCTCCTGTACCAGCTGCGCCTGCGCCGCCCCCGCCCCCGCCACCACCACCACCAGGAGCAC
AT
CTCTATGAAGAACTGGGAGAGAGCGCAATGCATAATCTTTTCCTTCTCTACCATTTTGAACAAAGCAG
G
GGAAATAACTCAGTCCCAGAAGACAGGAGCAGTCATCGCGATGGGATGGCCTTTTCCTCCAGTACCACT
GAG
TCTCATGAGCCAGCTCATGTAGAGGGACCACTTAAGGAGAGCCAGCCTAACCCAGCAAGGACGTTCT
CA
TTTGTTCCTGATGAGGATAACTTAAGTACCCATAATCCCCTTTACATGGAAAGTATAGGTCAAAGGTC
A
ACAAACTCAGACCTTCAGCCACGAACAGATTTTGAAGAGCTGTTGGCACCCAGAACACAAGTTAAGAGT
CAG
TCTCTGAGGGGCCCAAGAGAAAAGATCCAGAGGGTGTGGAATCAGTCTGTGAGCTTTCCTAGGCGGC
TC
ATGTGGAAAGCCCCAAACAGGCCAGAGACCATAGACCTGGTGGAGTGGCAGATCACCAATCAGAGAGC
T
GAATGCGAAAGCGCCAGATGCCACCCAAGCCAGAGAGGTAGCAGCAACGTTCTGCTGGCAACTGAAGAT
GCC
CACGAGTCAGAGAAAGAAGGGGGACACAGAGACACCCTAATCGTCCAGCAAACAGAGCAGCTGAAAT
CT
CTGTCTTCTGGCTCTTCTTTTTCCTCCTCTTGGTCTCACTTTTCTTTCTCAACTCTGCCAACGATTTC
C
AGAGCGGTGGAACTCGGGTCGGAACCTAATGTGGTCACTTCTCCCGCTGACTGCACCTTGGAACTTTCT
CCT
CCTCTGAGACCCCGTATTTTAAACTCCTTAAGCTCTAAGAGAGAGACTCCCACATGTGCATCAGATA
CA
GAACCAAAAAGGAACTCTTTTGAGATCGCTCCCCATCCACCTAGCATCTCTGCTCCCCTCCCACATCC
G
CCTCTTCCTAGACCTCCCATTGCCTTTACCACTTTTCCTCTTCCCCTTTCTCCCCCTAACCCTCCTCCC
CCA
CAACTTGTTACATTTTCTCTTCCCATTTCTACACCCCCTACTTCTTCTCTACCTCTTCCTCCTCCAC
TG
TCACTTCCTCCTCCTCCTCGGCCACCAGCTCCCCGCCTCTTCCCACAGCCTCCTTCCACGTCCATTCC
A
TCCACAGACAGCATCTCTGCACCAGCTGCTAAATGCACTGCCAGTGCCACACACGCCAGAGAAACCACG
TCT
ACGACACAGCCACCAGCATCCAACCCGCAGTGGGGGGCAGAACCCCACAGACATCCAAAAGGGATCC
TC
AGACATGTGAAAAACTTGGCAGAGCTCGAGAAATCAGTGTCTAACATGTACAGTCACATAGAAAAAAA
C
TGCCCACCTGCAGATCCCTCAAAACTACACACGTTTTGCCCTGCAGAGAAAACAGGCATGAAAATCACA
CAT
GACCAGAGCCAGGAAACGTTGGTTAGAGTTGTTGAGGGAATTGACGTGCAACCTCACAGTCAATCAA
CA
TCTTTGTAA


Translation (1916 aa):
MFLQFAVWKCLPHGILIASLLVVSWGQYDDGTILVDNMLIKGTAGGPDPTIELSLKDNVDYWVLLDPVKQ
M
LFLNSTGRVLDRD
PPMNIHSIVVQVQCVNKKVGTVIYHEVRIVVRDRNDNSPTFKHESYYATVNELTPV
G
TTIFTGFSGDNGATDIDDGPNGQIEYVIQYNPEDP
TSNDTFEIPLMLTGNVVLRKRLNYEDKTRYYVII
Q
AN
DRAQNLNERRTTTTTLTVDVLDGDDLGPMFLPCVLVPNTRDCRPLTYQAAIPELRTPEELNPILVTP
P
IQAIDQDRNIQPPSDRPGILYSILV
GTPEDYPRFFHMHPRTAELTLLEPVNRDFHQKFDLVIKAEQDNG
H
PLPAFASLHIEILDENNQSPYFTMPSYQGYILESAPVGATISESLNLTTPLRIVALDKDIED
TKDPELH
L
FLNDYTSVFTVTPTGITRYLTLLQPVDREEQQTYTFL
ITAFDGVQESEPVVVNIRVMDANDNTPTFPEI
S
YDVYVYTDMSPGDSVIQ
LTAVDADEGSNGEISYEILVGGKGDFVINKTTGLVSIAPGVELIVGQTYALT
V
QASDNAPPAER
RHSICTVYIEVLPPNNQSPPRFPQLMYSLEVSEAMRIGAILLNLQATDREGDPITYAI
E
NGDPQRVFNLSE
TTGILSLGKALDRESTDRYILIVTASDGRPDGTSTATVNIVVTDVNDNAPVFDPYLP
R
NLSVVEEEANAFVGQVR
ATDPDAGINGQVHYSLGNFNNLFRITSNGSIYTAVKLNREARDHYELVVVAT
D
GAVHPRHSTLTLYIKVLDIDDNSPVFTNSTYTVVVEENLPAGTSFLQIE
AKDVDLGANVSYRIRSPEVK
H
LFALHPFTGELSLLRSLDYEAFPDQEASITFLVEAFDIYGTMPPGIATVTVIVK
DMNDYPPVFSKRIYK
G
MVAPDAVKGTPITTVYAEDADPP
GMPASRVRYRVDDVQFPYPASIFDVEEDSGRVVTRVNLNEEPTTIF
K
LVVVAFDDGEPVMSSSATVRILVLHPGEIPRFTQEEYRPPPVSELAARGTVVGVISAAAINQSIVYSIV
A
GNEE
DKFGINNVTGVIYVNSPLDYETRTSYVLRVQADSLEVVLANLRVPSKSNTAKVYIEIQDENDHPP
V
FQKKFYIGGVSEDARMFASVLRVK
ATDRDTGNYSAMAYRLIIPPIKEGKEGFVVETYTGLIKTAMLFHN
M
RRSYFKFQVIATDDYGKGLSGKADVL
VSVVNQLDMQVIVSNVPPTLVEKKIEDLTEILDRYVQEQIPGA
K
VVVESIGARRHGDAYSLEDYSKCDLTVYAIDPQTNRAIDRNELF
KFLDGKLLDINKDFQPYYGEGGRIL
E
IRTPEAVTSIKKRGESLGYTEGALLALAFIIILCCIPAILVVLVSYR
QFKVRQAECTKTARIQSAMPAA
K
PAAPVPAAPAPPPPPPPPPPGAHLYEELGESA
MHNLFLLYHFEQSRGNNSVPEDRSSHRDGMAFSSSTT
E
SHEPAHVEGPLKESQPNPARTFSFVPDEDNLSTHNPLYMESIGQRSTNSDLQPRTDFEELLAPRTQVKS
Q
SLRGPREKIQRVWNQSVSFPRRLMWKAPNRPETIDLVEWQITNQRAECESARCHPSQRGSSNVLLATED
A
HESEKEGGHRDTLIVQQTEQLKSLSSGSSFSSSWSHFSFSTLPTISRAVELGSEPNVVTSPADCTLELS
P
PLRPRILNSLSSKRETPTCASDTEPKRNSFEIAPHPPSISAPLPHPPLPRPPIAFTTFPLPLSPPNPPP
P
QLVTFSLPISTPPTSSLPLPPPLSLPPPPRPPAPRLFPQPPSTSIPSTDSISAPAAKCTASATHARETT
S
TTQPPASNPQWGAEPHRHPKGILRHVKNLAELEKSVSNMYSHIEKNCPPADPSKLHTFCPAEKTGMKIT
H
DQSQETLVRVVEGIDVQPHSQSTSL




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser