NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS56672.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
56672.1 Public Mus musculus 10 Mthfd1l 21 106 86 CCDS HistoryNCBI Gene:270685Re-query CCDS DB by CCDS ID:56672.1Re-query CCDS DB by GeneID:270685See the combined annotation on chromosome 10 in Sequence Viewer

Public since: CCDS release 10, NCBI annotation release 38.1, Ensembl annotation release 68

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 56672.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000043735 ENSMUSP00000036178 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000043735Link to Ensembl Protein Viewer:ENSMUSP00000036178Re-query CCDS DB by Nucleotide ID:ENSMUST00000043735Re-query CCDS DB by Protein ID:ENSMUSP00000036178
Original member Current member EBI,WTSI ENSMUST00000117291 ENSMUSP00000112870 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000117291Link to Ensembl Protein Viewer:ENSMUSP00000112870Re-query CCDS DB by Nucleotide ID:ENSMUST00000117291Re-query CCDS DB by Protein ID:ENSMUSP00000112870
Original member Current member EBI,WTSI ENSMUST00000120585 ENSMUSP00000112897 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000120585Link to Ensembl Protein Viewer:ENSMUSP00000112897Re-query CCDS DB by Nucleotide ID:ENSMUST00000120585Re-query CCDS DB by Protein ID:ENSMUSP00000112897
Original member Current member EBI,WTSI OTTMUST00000074096 OTTMUSP00000038447 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000074096Link to Vega Protein Viewer:OTTMUSP00000038447Re-query CCDS DB by Nucleotide ID:OTTMUST00000074096Re-query CCDS DB by Protein ID:OTTMUSP00000038447
Original member Current member EBI,WTSI OTTMUST00000074097 OTTMUSP00000038448 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000074097Link to Vega Protein Viewer:OTTMUSP00000038448Re-query CCDS DB by Nucleotide ID:OTTMUST00000074097Re-query CCDS DB by Protein ID:OTTMUSP00000038448
Original member Current member EBI,WTSI OTTMUST00000074098 OTTMUSP00000038449 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000074098Link to Vega Protein Viewer:OTTMUSP00000038449Re-query CCDS DB by Nucleotide ID:OTTMUST00000074098Re-query CCDS DB by Protein ID:OTTMUSP00000038449
Original member Current member NCBI NM_001170785.1 NP_001164256.1 Accepted alive Link to Nucleotide Sequence:NM_001170785.1Link to Protein Sequence:NP_001164256.1Re-query CCDS DB by Nucleotide ID:NM_001170785Re-query CCDS DB by Protein ID:NP_001164256Link to BLink:NP_001164256.1
Original member Current member NCBI NM_001170786.1 NP_001164257.1 Accepted alive Link to Nucleotide Sequence:NM_001170786.1Link to Protein Sequence:NP_001164257.1Re-query CCDS DB by Nucleotide ID:NM_001170786Re-query CCDS DB by Protein ID:NP_001164257Link to BLink:NP_001164257.1
Original member Current member NCBI NM_172308.4 NP_758512.3 Accepted alive Link to Nucleotide Sequence:NM_172308.4Link to Protein Sequence:NP_758512.3Re-query CCDS DB by Nucleotide ID:NM_172308Re-query CCDS DB by Protein ID:NP_758512Link to BLink:NP_758512.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001164256.1 977 Q3V3R1 977 100% 0 0
NP_001164257.1 977 Q3V3R1 977 100% 0 0
NP_758512.3 977 Q3V3R1 977 100% 0 0

Chromosomal Locations for CCDS 56672.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 10 (NC_000076.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 10Link to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10See the combined annotation on chromosome 10 in Sequence Viewer

Chromosome Start Stop Links
10 3973255 3973478 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 3978634 3978718 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 3980216 3980266 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 3980351 3980404 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 3984084 3984208 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 3985566 3985666 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 3989861 3989997 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 4007742 4007853 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 4015514 4015605 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 4016724 4016821 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 4018426 4018599 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 4028395 4028531 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 4030690 4030736 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 4032232 4032339 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 4033289 4033363 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 4035216 4035318 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 4041773 4041849 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 4047831 4047971 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 4048200 4048268 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 4056750 4056861 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 4083737 4083876 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 4088234 4088275 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 4089295 4089395 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 4089996 4090173 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 4103236 4103343 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 4106377 4106529 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 4148009 4148098 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2934 nt):
ATGAGCGTCCGCCTCCCTCTCCTGCTTCGCCAGCTCGGCCGCCAGCAGCTGCCCTCGGGCCCGGCGTGTC
GC
CTCCGTGAGCTGTGTCGCTCAGGCAGCAGAAGCAGCAGCAGCGGAGGTGGTGACCCCGAGGGGTTACG
C
GGGCGGCGGCTGCAGGATGGCCAAACCTTCAGCAGCCATGGCCCAGGCAATCCGGAAGCCCCCGGGATG
GAC
TCCATCGTCAGAGACGTCATTCACAATTCCAAGGAAGTGCTGAGCTTGTTGCAAGAAAAGAACCCTG
CC
TTTAAGCCAGTGCTTGTGGTTATTCAGGCCGGTGATGACAATTTGATGAAGGATATGAACCAGAATTT
G
GCCAAGGAGGCTGGTCTGGACATCACTCACATCTGCTTGCCTCCAGACAGCGGAGAGGATGAGATCATA
GAT
GAAATCCTGAAGATTAATGAAGACCCCAGAGTGCATGGCCTTACCCTTCAGATCTCTGAAGATTCAT
TG
AGCAACAAAGTTCTCAATGCTTTGAAACCAGAAAAAGATGTGGACGGGGTGACCGACATCAATCTGGG
G
AAGCTCGTACGAGGTGACGCTCCGGAGTGTTTTGTTTCACCCTTGGCCAAAGCTGCTGTAGAACTTGTT
GAA
AAGTCAGGGATCACTTTGGATGGAAAGAAGGTCTTGGTCGTAGGGGCGCACGGGCCCCTGGAAGCTG
CC
CTGCAGTGGCTTTTCCAGAGAAAAGGATCTATGACAATGAGCTGCCCCTGGGCAACACCTCAGCTTCC
A
GACAAGCTTCGAGAGGCAGACATTGTGGTCTTAGGCTCACCTAAGCCAGAAGAGATTCCTGCTGTGTGG
ATT
CCATCAGGAACCACCATTCTCAATTGCTTCCATGACTTCTTGTCAGGGAAGCTGAGCGGAGGTTCTC
CT
GGGGTCCCCGTGGACAAACTCATTGCAGAAGAGAGCGTGAGTCTCCTTGCTGCGGCTCTGCGCATTCA
G
AACATGGTGAGCAGCGGCAGGAGGTGGCTCAGAGAGCAGCAACATCGAAGATGGCGACTGCACTGCTTG
AAA
CTGCAGCCTCTCTCACCTGTGCCCAGTGATATTGAGATTTCTCGAGGACAGACTCCAAAAGCTGTGG
AT
GTCCTTGCCAAGGAGATAGGATTGCTTGCAGATGAAATTGAAATCTATGGCAAGAGCAAAGCCAAAGT
C
CAATTGTCCCTGCTGGAGAGGTTAAAGGATCAAACAGATGGAAAATACGTCTTGGTTGCTGGGATCACG
CCC
ACCCCGCTCGGAGAAGGGAAGAGTACAGTCACCATCGGACTAGTGCAGGCGCTGACCGCTCACCTGA
AA
GTCAACTCCTTCGCCTGTCTGAGGCAGCCTTCTCAGGGACCCACTTTTGGAGTGAAAGGAGGAGCTGC
A
GGAGGTGGATATGCTCAGGTCATCCCCATGGAGGAGTTCAACCTTCACCTGACTGGGGACATCCATGCC
ATC
ACTGCCGCTAATAACTTGCTGGCCGCAGCCATCGACACGAGAATTTTACATGAGAGCACTCAAACAG
AC
AAGGCTCTCTACAATCGACTGGTTCCCTTAGTGAATGGTGTCAGAGAATTTTCAGAAATTCAACTTTC
T
CGGCTGAAGAAACTGGGGATACATAAGACTGATCCAAGCACACTGACCGAGGAGGAAGTGAGGAAGTTC
GCC
CGCCTCAACATTGACCCCGCAACCATCACGTGGCAGAGAGTATTGGACACGAACGACCGATTTCTGA
GA
AAAATAACCATTGGACAGGGAAGTACAGAGAAAGGATATTCCCGGCAGGCACAGTTTGACATTGCAGT
G
GCCAGCGAGATCATGGCCGTGCTGGCCTTGACTGATAGCCTCACAGACATGAAAGAGCGGCTAGGAAGA
ATG
GTGGTGGCCAGTGACAAAGACGGGCAGCCTGTGACAGCTGAGGACTTGGGGGTGACCGGCGCTCTGA
CA
GTTTTGATGAAAGACGCCATCAAGCCAAATCTGATGCAGACCCTTGAAGGAACACCTGTGTTTGTGCA
C
GCTGGTCCCTTTGCCAACATCGCTCACGGCAACTCATCAGTATTAGCTGATAAAATCGCGCTGAAATTG
GTC
GGCGAAGAAGGGTTTGTGGTGACTGAAGCTGGCTTTGGGGCTGATATTGGGATGGAGAAATTCTTCA
AT
ATCAAATGCCGAGCTTCTGGCCTGGTGCCCAACGTTGTCGTGCTGGTAGCCACCGTTCGAGCTCTGAA
G
ATGCATGGAGGCGGGCCGAGTGTAACTGCTGGGGTTCCTCTCAAGAAAGAATATACAGAGGAGAACATT
CAG
CTGGTAGCTGATGGCTGCTGCAACCTACAGAAGCAAATTCAGATCGCTCAGCTCTTCGGGGTGCCGG
TG
GTGGTGGCACTGAATGTCTTCAAGACGGACACCCGTGCAGAGATTGACTTGGTGTGTGAGCTCGCTAA
A
CGGGCCGGTGCCTTTGATGCGGTCCCCTGCTATCACTGGTCGGCTGGAGGGAAAGGATCTGTGGACTTG
GCC
CGGGCTGTGAGAGAAGCTGCGAATAAAAGAAGCCGCTTCCAGTTCCTGTATGATGTTCAGCTTCCCA
TC
GTGGAAAAGATAAGAGTCATTGCCCAGACTGTCTATGGAGCCAAGGACATTGAGCTGTCTCCTGAGGC
G
CAGTCCAAAATCGATCGCTATACGCAACAGGGTTTTGGAAATTTGCCCATTTGCATGGCGAAGACCCAC
CTC
TCTCTCTCTCATGAACCTGACAAAAAGGGAGTGCCGAGGGATTTCACTCTGCCCATCAGTGATGTCC
GG
GCCAGCATCGGGGCTGGGTTCATTTATCCTTTGGTGGGAACGATGAGCACAATGCCAGGACTGCCCAC
C
CGACCCTGCTTTTATGATATAGACCTTGACACAGAAACGGAGCAAGTTAAAGGCTTGTTCTAA


Translation (977 aa):
MSVRLPLLLRQLGRQQLPSGPACRLRELCRSGSRSSSSGGGDPEGLRGRRLQDGQTFSSHGPGNPEAPGM
D
SIV
RDVIHNSKEVLSLLQEKNPAFKPVLVVIQAGDDNLMKDMNQNLAKEAGLDITHICLPPDSGEDEII
D
EILKINEDPRVHGLTLQISEDSLSNKVLNALKPEKDVD
GVTDINLGKLVRGDAPECFVSPLAKAAVELV
E
KS
GITLDGKKVLVVGAHGPLEAALQWLFQRKGSMTMSCPWATPQLPDKLREADIVVLGSPKPEEIPAVW
I
PSGTTILNCFHDFLS
GKLSGGSPGVPVDKLIAEESVSLLAAALRIQNMVSSGRRWLREQQHRRWRLHCL
K
LQPLSPVP
SDIEISRGQTPKAVDVLAKEIGLLADEIEIYGKSKAKVQLSLLERLKDQTDGKYVLVAGIT
P
TPLGEGKSTVTIGLVQALTAHLKVNSFACLRQPSQGPTFGVK
GGAAGGGYAQVIPMEEFNLHLTGDIHA
I
TAANNLLAAAIDTRILHESTQTDK
ALYNRLVPLVNGVREFSEIQLSRLKKLGIHKTDPSTLTEEEVRKF
A
RLNIDPATITWQR
VLDTNDRFLRKITIGQGSTEKGYSRQAQFDIAVASEIMAVLALTDSLTDMKERLGR
M
VVASDKDGQPVTAEDL
GVTGALTVLMKDAIKPNLMQTLEGTPVFVHAGPFANIAHGNSSVLADKIALKL
V
GEEGFV
VTEAGFGADIGMEKFFNIKCRASGLVPNVVVLVATVRALKMHGGGPSVTAGVPLKKEYTEENI
Q
LVADGCCNLQKQIQIAQLFGVPVVVALNVF
KTDTRAEIDLVCELAKRAGAFDAVPCYHWSAGGKGSVDL
A
RAVREAANKRSRFQFLYDVQ
LPIVEKIRVIAQTVYGAKDIELSPEAQSKIDRYTQQGFGNLPICMAKTH
L
SLSHEPDKKGVPRDFTLPISDVRASIGAGFIYPLVGT
MSTMPGLPTRPCFYDIDLDTETEQVKGLF



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser