NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS53071.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
53071.1 Public Mus musculus X 1700013H16Rik 21 106 86 CCDS HistoryNCBI Gene:75514Re-query CCDS DB by CCDS ID:53071.1Re-query CCDS DB by GeneID:75514See the combined annotation on chromosome X in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 53071.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000067940 ENSMUSP00000063474 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000067940Link to Ensembl Protein Viewer:ENSMUSP00000063474Re-query CCDS DB by Nucleotide ID:ENSMUST00000067940Re-query CCDS DB by Protein ID:ENSMUSP00000063474
Original member Current member EBI,WTSI OTTMUST00000042175 OTTMUSP00000018952 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000042175Link to Vega Protein Viewer:OTTMUSP00000018952Re-query CCDS DB by Nucleotide ID:OTTMUST00000042175Re-query CCDS DB by Protein ID:OTTMUSP00000018952
Original member Current member NCBI NM_001200013.1 NP_001186942.1 Accepted alive Link to Nucleotide Sequence:NM_001200013.1Link to Protein Sequence:NP_001186942.1Re-query CCDS DB by Nucleotide ID:NM_001200013Re-query CCDS DB by Protein ID:NP_001186942Link to BLAST:NP_001186942.1

Chromosomal Locations for CCDS 53071.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome X (NC_000086.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome XSee the combined annotation on chromosome X in Sequence Viewer

Chromosome Start Stop Links
X 53743166 53743186 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 53743352 53743456 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 53745653 53745751 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 53746942 53747041 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 53747823 53747940 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 53750014 53750048 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 53751023 53751086 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 53751510 53751843 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (876 nt):
ATGTTTCCCCGTGGAAGAAGGGACCCTGAAGAATTTAAAAGCACCCCAGAGGACCCTGAAGAACCTGAAA
GC
ACCACAAGGGACCCTGGAGGACTTGAAAGCACCCCAGGGGACCCTGAAGGATTTGAAAGCACCCCAGG
G
GATCCTGAAGGATTTGAAAGCACCCCGGGGGACCCTAAAGGATTTGAAAGCACCCCGGGGGACCCTGAA
GGA
TTTGAAAGCACCCCAGGGGACCCTGTAGGATTTGAAAGCACCCCAACAGAGGAAGAACATTTAGCAG
TT
TATTCCTTTGATGATGACTTTCAGCATCCCAGGGTTTTGCAGAGGAGTGAAGAACTGCGTTCAACATC
T
GATTCATGTCGGGAGAGAAGTCCTGTAGAACTGTTTACAGATCCAGGGGAAAAGGTGGAGGTTATGCTT
GGA
AGAATTGGAGTTGACATTAACCGTGCTCTTAGTGCTAAGAGACAAAGAATGGAGACAACTGCCAGAC
AG
TCTTTTGAGGGAGTTGAGCAGAAAATGAAAGAAGTTTGGAACTCTCATGAAGATGCAATGGCACAGCT
T
AATGAAGAGTCTGCTCAGGCATTTGCAAATCTGTTTGAGCAATGGAATGAGGATTTTAAGAAATTCCGA
GAA
CAACATGAGAAACTTGTGAATGATTTTAAGCAACAGGAGAAGATTTTTCAACGAACTAGATTTGTTC
AG
AACCAGAGAATTAGAACAATTAAAGAAATACATGAACAATTCTTACAGAAATTGGAAGACCTGGAGAG
C
AAGAATGATGATCTGCTTACTAGAACACAAAATGAACTTAAGGATGAAATTAATGATCTGCAGAAAAAA
ATT
TTGAGAGAATCTGAGGAGTCTACGCTCTTTTGA


Translation (291 aa):
MFPRGRRDPEEFKSTPEDPEEPESTTRDPGGLESTPGDPEGFESTPGDPEGFESTPGDPKGFESTPGDPE
G
FESTPGDPVGFESTPTEEEHLAVYSFDDDFQHPRVLQRSE
ELRSTSDSCRERSPVELFTDPGEKVEVML
G
RIG
VDINRALSAKRQRMETTARQSFEGVEQKMKEVWNSHEDAMAQLNEESAQAFANLFEQWNEDFKKFR
E
QHEKLV
NDFKQQEKIFQRTRFVQNQRIRTIKEIHEQFLQKLEDLESKNDDLLTRTQNELKDEINDLQKK
I
LRES
EESTLF



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser