NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS52848.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
52848.1 Public Mus musculus 9 Tpm1 21 106 86 CCDS HistoryNCBI Gene:22003Re-query CCDS DB by CCDS ID:52848.1Re-query CCDS DB by GeneID:22003See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 52848.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000113705 ENSMUSP00000109335 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000113705Link to Ensembl Protein Viewer:ENSMUSP00000109335Re-query CCDS DB by Nucleotide ID:ENSMUST00000113705Re-query CCDS DB by Protein ID:ENSMUSP00000109335
Original member Current member EBI,WTSI OTTMUST00000048452 OTTMUSP00000022210 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000048452Link to Vega Protein Viewer:OTTMUSP00000022210Re-query CCDS DB by Nucleotide ID:OTTMUST00000048452Re-query CCDS DB by Protein ID:OTTMUSP00000022210
Original member Current member NCBI NM_001164249.1 NP_001157721.1 Accepted alive Link to Nucleotide Sequence:NM_001164249.1Link to Protein Sequence:NP_001157721.1Re-query CCDS DB by Nucleotide ID:NM_001164249Re-query CCDS DB by Protein ID:NP_001157721Link to BLAST:NP_001157721.1

Chromosomal Locations for CCDS 52848.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 67023359 67023441 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 67031029 67031098 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 67031452 67031514 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 67031951 67032026 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 67032794 67032864 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 67033876 67033993 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 67035995 67036128 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 67048124 67048249 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 67049019 67049132 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (855 nt):
ATGGACGCCATCAAGAAGAAGATGCAGATGCTGAAGCTCGACAAAGAGAACGCCTTGGATCGAGCTGAGC
AA
GCGGAGGCTGATAAGAAGGCGGCGGAAGACCGGAGCAAGCAGCTCGAGGAGGACATCGCAGCGAAAGA
G
AAGCTGCTGCGGGCGTCGGAGGACGAGCGGGACCGGGTGCTAGAGGAGCTGCACAAGGCGGAGGACAGC
CTC
CTGGCTGCCGACGAGACCGCCGCCAAGGCTGAAGCTGACGTAGCTTCTCTGAACAGACGCATCCAGC
TG
GTTGAGGAGGAGTTGGATCGTGCTCAGGAGCGTCTGGCCACAGCTCTGCAGAAGCTGGAGGAGGCCGA
G
AAGGCTGCAGATGAGAGTGAGAGAGGCATGAAAGTCATTGAAAGCCGAGCCCAAAAAGATGAAGAAAAG
ATG
GAGATTCAGGAGATCCAGCTGAAAGAGGCCAAGCACATTGCTGAAGATGCTGACCGGAAGTATGAAG
AG
GTGGCCCGTAAGCTGGTCATCATCGAGAGCGACCTGGAACGTGCAGAGGAGCGGGCTGAGCTCTCAGA
A
GGCAAATGTGCCGAGCTTGAAGAAGAATTGAAAACGGTGACGAACAACTTGAAGTCACTGGAGGCTCAG
GCT
GAGAAGTACTCTCAGAAGGAAGACAAATATGAAGAGGAGATCAAGGTTCTCTCTGACAAGCTGAAGG
AG
GCTGAAACTCGGGCTGAGTTTGCAGAGAGATCAGTAACCAAATTGGAGAAAAGCATTGATGACTTAGA
A
GAGAAAGTGGCCCATGCCAAAGAAGAAAACCTTAGTATGCACCAGATGCTGGATCAGACTTTACTGGAG
CTA
AACAACATGTGA


Translation (284 aa):
MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEEDIAAKEKLLRASEDERDRVLEELHKAEDS
L
LAADETAAK
AEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEK
M
EIQEIQLKEAKHIAEDADRKYEE
VARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQ
A
EK
YSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEEKVAHAKEENLSMHQMLDQTLLE
L
NNM




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser