NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS52716.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
52716.1 Public Mus musculus 9 Gria4 23 108 98 CCDS HistoryNCBI Gene:14802Re-query CCDS DB by CCDS ID:52716.1Re-query CCDS DB by GeneID:14802See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 52716.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000163309.1 ENSMUSP00000129316.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000163309.1Link to Ensembl Protein Viewer:ENSMUSP00000129316.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000163309Re-query CCDS DB by Protein ID:ENSMUSP00000129316
Original member Current member NCBI NM_001113181.1 NP_001106652.1 Accepted alive Link to Nucleotide Sequence:NM_001113181.1Link to Protein Sequence:NP_001106652.1Re-query CCDS DB by Nucleotide ID:NM_001113181Re-query CCDS DB by Protein ID:NP_001106652Link to BLAST:NP_001106652.1

Chromosomal Locations for CCDS 52716.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 4478820 4478852 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 4480178 4480288 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 4502374 4502478 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 4503562 4503729 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 4513223 4513381 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 4519486 4519539 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 4537635 4537819 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 4664768 4665007 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 4793810 4793968 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 4795187 4795274 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1302 nt):
ATGAGGATTATTTGCAGGCAGATTGTCTTGTTGTTTTCTGGATTTTGGGGACTCGCCATGGGAGCCTTTC
CG
AGCAGCGTTCAAATAGGTGGTCTCTTTATCCGAAACACAGACCAGGAATACACTGCTTTTCGGCTAGC
T
ATCTTTCTTCATAACACCAGCCCCAATGCATCTGAAGCCCCTTTCAATTTGGTACCTCATGTGGACAAC
ATT
GAGACTGCCAACAGTTTTGCTGTGACAAATGCATTCTGTTCCCAGTATTCTAGAGGGGTGTTTGCCA
TT
TTTGGACTCTATGACAAGAGGTCAGTGCATACCTTGACCTCCTTCTGCAGTGCTCTGCACATCTCTCT
C
ATCACACCAAGCTTCCCCACTGAAGGAGAGAGCCAGTTCGTGCTTCAGCTAAGACCTTCATTGAGAGGT
GCA
CTCCTGAGCCTCCTGGATCACTATGAATGGAATTGTTTTGTCTTCCTGTATGATACAGACAGGGGGT
AT
TCAATACTTCAAGCTATAATGGAAAAAGCAGGACAGAATGGATGGCATGTCAGTGCGATATGTGTGGA
A
AATTTTAACGATGTCAGCTACAGGCAACTACTAGAAGAGCTTGACAGAAGACAAGAGAAGAAATTTGTA
ATA
GATTGTGAGATAGAAAGGCTTCAAAACATATTAGAACAAATTGTGAGTGTTGGGAAGCACGTCAAAG
GC
TACCATTATATCATCGCAAATTTGGGTTTCAAAGATATTTCTCTTGAGAGATTTATACATGGAGGAGC
A
AATGTCACTGGATTCCAGTTAGTAGATTTTAATACGCCCATGGTGACGAAACTAATGGATCGCTGGAAG
AAA
CTAGATCAACGAGAATATCCAGGATCTGAAACACCTCCAAAGTACACTTCTGCTCTCACTTACGATG
GT
GTCTTGGTAATGGCTGAAACTTTCCGAAGTCTCAGAAGACAGAAAATTGATATTTCAAGGAGAGGAAA
T
GCCGGGGATTGTCTGGCAAACCCTGCTGCTCCCTGGGGCCAGGGAATTGACATGGAGAGAACACTGAAG
CAG
GTTCGAATTCAAGGACTGACTGGGAATGTTCAATTTGACCACTATGGACGTAGAGTTAATTACACAA
TG
GATGTGTTTGAATTAAAAAGCACAGGACCTCGAAAGGTTGGCTATTGGAACGATATGGATAAATTAGT
C
TTGATTCAAGATGCGCCTACTCTTGGCAATGACACAGCAGCTATCGAGAACAGAACAGTGGTTGTAACC
ACA
ATTATGCCTCTGATGAAGAATCCTATTTTAAGAAATTGA


Translation (433 aa):
MRIICRQIVLLFSGFWGLAMGAFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEAPFNLVPHVDN
I
ETANSFAVTNA
FCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITPSFPTEGESQFVLQLRPSLRG
A
LLSLLDHYEWNCFVFLYDTDR
GYSILQAIMEKAGQNGWHVSAICVENFNDVSYRQLLEELDRRQEKKFV
I
DCEIERLQNILEQ
IVSVGKHVKGYHYIIANLGFKDISLERFIHGGANVTGFQLVDFNTPMVTKLMDRWK
K
LDQREYPGSETPPK
YTSALTYDGVLVMAETFRSLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLK
Q
VRIQGLTGNVQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLIQDAPTLGNDTAAIENRTVVVT
T
IM
PLMKNPILRN



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser