NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS52707.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
52707.1 Public Mus musculus 8 Disc1 21 106 86 CCDS HistoryNCBI Gene:244667Re-query CCDS DB by CCDS ID:52707.1Re-query CCDS DB by GeneID:244667See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 52707.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000098311 ENSMUSP00000095914 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000098311Link to Ensembl Protein Viewer:ENSMUSP00000095914Re-query CCDS DB by Nucleotide ID:ENSMUST00000098311Re-query CCDS DB by Protein ID:ENSMUSP00000095914
Original member Current member EBI,WTSI ENSMUST00000118942 ENSMUSP00000112410 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000118942Link to Ensembl Protein Viewer:ENSMUSP00000112410Re-query CCDS DB by Nucleotide ID:ENSMUST00000118942Re-query CCDS DB by Protein ID:ENSMUSP00000112410
Original member Current member EBI,WTSI OTTMUST00000080764 OTTMUSP00000043041 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000080764Link to Vega Protein Viewer:OTTMUSP00000043041Re-query CCDS DB by Nucleotide ID:OTTMUST00000080764Re-query CCDS DB by Protein ID:OTTMUSP00000043041
Original member Current member NCBI NM_174854.2 NP_777279.2 Accepted alive Link to Nucleotide Sequence:NM_174854.2Link to Protein Sequence:NP_777279.2Re-query CCDS DB by Nucleotide ID:NM_174854Re-query CCDS DB by Protein ID:NP_777279Link to BLink:NP_777279.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_777279.2 852 Q811T9-1 852 100% 0 0

Chromosomal Locations for CCDS 52707.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 8 (NC_000074.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 8Link to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 125054230 125054284 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 125087454 125088448 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 125090373 125090442 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 125124493 125124640 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 125132063 125132183 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 125135274 125135509 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 125148412 125148466 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 125155008 125155110 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 125164993 125165181 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 125218097 125218157 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 125232784 125233057 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 125250948 125251065 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 125261015 125261148 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2559 nt):
ATGCAGGGCGGGGGTCCCCGGGGCGCTCCGATCCACAGTCCGAGCCACGGCGCAGACAGTGGGCATGGCT
TA
CCGCCTGCAGTAGCCCCTCAGAGGCGGCGGCTGACACGGAGACCAGGCTACATGAGAAGCACAGCGGG
T
TCTGGGATCGGGTTCCTCTCTCCAGCAGTGGGCATGCCACACCCGAGCTCAGCAGGGCTGACAGGCCAG
CAG
TCCCAACACTCACAGTCCAAGGCTGGACAGTGCGGACTTGACCCTGGGAGCCACTGCCAAGCCTCAC
TG
GTGGGCAAGCCTTTTCTCAAGAGCTCCCTTGTCCCTGCTGTGGCCTCTGAGGGCCACCTGCACCCAGC
C
CAGCGCTCTATGAGAAAAAGACCAGTGCACTTTGCGGTTCATTCCAAGAATGACAGCAGACAATCTGAG
AGG
CTGACTGGGTCATTTAAGCCTGGGGACAGTGGGTTTTGGCAAGAATTATTATCTTCAGACAGCTTTA
AG
TCTCTGGCTCCTAGCCTTGATGCACCCTGGAACAAGGGATCAAGGGGCCTGAAGACTGTGAAACCTCT
G
GCATCACCGGCGTTGAATGGCCCCGCTGATATCGCATCCCTTCCCGGCTTCCAAGACACCTTCACTTCC
AGC
TTCAGCTTCATCCAACTCTCCCTTGGTGCTGCTGGAGAACGCGGAGAAGCAGAAGGTTGCCTGCCAT
CC
AGAGAGGCCGAACCTCTGCATCAGAGGCCCCAAGAGATGGCAGCTGAAGCATCTAGCTCAGACAGGCC
C
CACGGGGATCCTCGGCATCTCTGGACCTTCAGTCTTCACGCTGCTCCAGGCTTGGCGGACTTGGCTCAG
GTG
ACAAGGAGCAGCAGCAGGCAATCAGAATGTGGCACGGTCTCCTCCTCCTCCTCGGACACTGGCTTCT
CT
TCCCAGGATGCATCCTCCGCTGGTGGGCGGGGCGACCAGGGCGGCGGCTGGGCCGATGCCCATGGATG
G
CATACATTGCTCAGGGAATGGGAGCCCATGCTGCAGGACTACCTACTGAGCAACCGCAGGCAGCTGGAG
GTC
ACTTCCTTAATTTTAAAGCTTCAGAAATGTCAAGAAAAAGTGGTCGAGGATGGCGATTACGATACTG
CA
GAGACATTGAGACAGAGGTTGGAAGAACTGGAACAGGAGAAAGGCCGCCTGTCCTGGGCTCTGCCTTC
A
CAGCAACCTGCTCTTCGCAGCTTCTTGGGTTACCTGGCAGCACAGATACAGGTGGCCTTGCATGGAGCC
ACC
CAAAGGGCCGGCAGCGATGATCCAGAAGCCCCACTTGAAGGACAGCTGAGGACTACCGCCCAGGATA
GC
CTGCCTGCATCCATCACCAGGAGGGACTGGCTTATTCGAGAGAAACAGCGATTGCAGAAGGAAATCGA
A
GCTCTCCAAGCACGGATGTCTGCGCTGGAGGCAAAGGAAAAACGGCTGAGCCAAGAGTTGGAGGAGCAG
GAG
GTGCTGCTCCGGTGGCCGGGCTGTGACCTGATGGCACTGGTGGCCCAGATGTCCCCAGGCCAGCTGC
AG
GAGGTCAGCAAGGCCTTGGGAGAGACCCTGACCTCTGCCAACCAGGCTCCCTTCCAGGTGGAGCCACC
T
GAGACCCTCAGGAGCCTCCGGGAAAGGACAAAATCACTGAACCTGGCTGTCAGAGAACTCACTGCTCAG
GTG
TGCTCAGGTGAGAAGCTGTGCAGCTCTCTGAGGAGGAGACTCAGTGACCTCGACACCAGGCTGCCTG
CC
TTGCTGGAAGCCAAGATGCTGGCCCTATCAGGAAGCTGCTTCTCCACAGCCAAGGAGCTCACGGAGGA
G
ATTTGGGCCTTGTCGTCAGAGCGGGAAGGGCTAGAGATGTTCCTGGGCAGGCTGTTGGCACTCAGCTCC
AGG
AACAGCAGAAGGCTGGGCATCGTCAAAGAGGATCACCTCAGGTGCAGGCAGGACCTGGCACTCCAGG
AC
GCCGCCCACAAAACACGCATGAAGGCAAACACTGTGAAGTGCATGGAAGTGTTGGAAGGTCAGCTGAG
C
AGCTGCAGGTGCCCGCTGCTTGGGAGAGTGTGGAAAGCAGACTTGGAGACTTGTCAGTTGCTAATGCAG
AGC
CTGCAGCTTCAGGAAGCAGGCAGCAGCCCACACGCAGAGGACGAGGAGCAGGTGCATAGCACAGGAG
AG
GCCGCCCAGACAGCTGCTCTGGCTGTCCCTCGAACACCCCACCCCGAAGAAGAAAAGTCCCCCTTGCA
G
GTGCTCCAGGAGTGGGACACCCACTCAGCTCTTTCACCACACTGTGCTGCAGGCCCATGGAAAGAGGAT
TCT
CACATCGTTTCTGCTGAAGTTGGAGAAAAGTGCGAAGCCATAGGCGTGAAGCTCCTACACCTGGAAG
AC
CAGCTTCTCGGAGCCATGTACAGTCACGATGAGGCTCTCTTTCAGTCTCTCCAGGGGGAGCTCCAGAC
G
GTGAAGGAAACACTGCAGGCCATGATCCTGCAGCTCCAGCCAACAAAGGAGGCAGGAGAGGCCTCAGCT
TCC
TATCCGACAGCTGGTGCTCAGGAAACCGAGGCCTGA


Translation (852 aa):
MQGGGPRGAPIHSPSHGADSGHGLPPAVAPQRRRLTRRPGYMRSTAGSGIGFLSPAVGMPHPSSAGLTGQ
Q
SQHSQSKAGQCGLDPGSHCQASLVGKPFLKSSLVPAVASEGHLHPAQRSMRKRPVHFAVHSKNDSRQSE
R
LTGSFKPGDSGFWQELLSSDSFKSLAPSLDAPWNKGSRGLKTVKPLASPALNGPADIASLPGFQDTFTS
S
FSFIQLSLGAAGERGEAEGCLPSREAEPLHQRPQEMAAEASSSDRPHGDPRHLWTFSLHAAPGLADLAQ
V
TRSSSRQSECGTVSSSSSDTGFSSQDASSAGGRGDQGGGWADAHGWHTLLREWEPMLQDYLLSNRRQLE

V
TSLILKLQKCQEKVVEDGDYDT
AETLRQRLEELEQEKGRLSWALPSQQPALRSFLGYLAAQIQVALHGA
T
Q
RAGSDDPEAPLEGQLRTTAQDSLPASITRRDWLIREKQRLQKEIEALQARMSALEAKEKRLSQELEEQ
E
VLLRWPGCDLMALVAQMSPGQLQEVSKALGETLTSANQAPFQVEPPETLR
SLRERTKSLNLAVRELTAQ
V
CSGEKLCSSLRRRLSDLDTRLPALLEAKMLALS
GSCFSTAKELTEEIWALSSEREGLEMFLGRLLALSS
R
NSRRLGIVKEDHLRCRQDLALQDAAH
KTRMKANTVKCMEVLEGQLSSCRCPLLGRVWKADLETCQLLMQ
S
LQLQEAGSSPHAEDEEQVHSTGEAAQTAALAVPRTPHPEEEKSPLQVLQEWDTHSALSPHCAAGPWKE
D
S
HIVSAEVGEKCEAIGVKLLHLEDQLLGAMYSHDEALF
QSLQGELQTVKETLQAMILQLQPTKEAGEASA
S
YPTAGAQETEA




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser