NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS52695.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
52695.1 Public Mus musculus 8 Piezo1 21 106 86 CCDS HistoryNCBI Gene:234839Re-query CCDS DB by CCDS ID:52695.1Re-query CCDS DB by GeneID:234839See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Provisional (this record has not been manually reviewed by the collaboration)


Attributes
Inferred exon combination

Sequence IDs included in CCDS 52695.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000067252 ENSMUSP00000089777 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000067252Link to Ensembl Protein Viewer:ENSMUSP00000089777Re-query CCDS DB by Nucleotide ID:ENSMUST00000067252Re-query CCDS DB by Protein ID:ENSMUSP00000089777
Original member Current member NCBI NM_001037298.1 NP_001032375.1 Accepted alive Link to Nucleotide Sequence:NM_001037298.1Link to Protein Sequence:NP_001032375.1Re-query CCDS DB by Nucleotide ID:NM_001037298Re-query CCDS DB by Protein ID:NP_001032375Link to BLAST:NP_001032375.1

Chromosomal Locations for CCDS 52695.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 8 (NC_000074.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 122481982 122482231 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122482310 122482526 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122482649 122482728 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122482869 122482991 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122483057 122483229 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122483319 122483411 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122483486 122483674 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122484729 122484876 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122484962 122485120 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122485257 122485471 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122485590 122485737 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122485824 122485956 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122486307 122486619 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122486755 122486943 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122487010 122487268 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122487475 122487681 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122487838 122487944 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122488075 122488247 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122488334 122488390 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122488461 122488554 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122489099 122489199 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122489555 122489626 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122490063 122490163 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122490239 122490328 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122490855 122491026 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122491119 122491215 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122491315 122491558 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122491659 122491812 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122492607 122492711 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122494790 122494994 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122495417 122495617 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122495734 122495859 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122496403 122496579 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122496740 122496900 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122497452 122497564 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122497806 122497988 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122498151 122498299 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122498393 122498571 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122498660 122498771 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122499628 122499885 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122500204 122500304 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122501162 122501249 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122501330 122501416 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122501506 122501677 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122501766 122501979 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122502122 122502308 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122506029 122506167 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122506266 122506308 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122507623 122507745 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122513714 122513809 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122550975 122551038 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (7641 nt):
ATGGAGCCGCACGTGCTGGGCGCCGGGCTCTACTGGCTGTTGCTGCCCTGCACGCTCCTGGCGGCCTCCC
TG
TTACGCTTCAATGCTCTCTCGCTGGTCTATTTGCTGTTTCTACTGCTGCTGCCCTGGCTTCCAGGCCC
C
TCAAGACACAGCATACCAGGTCACACAGGTCGCCTGCTCCGTGCACTACTCTGCCTCAGCCTCCTCTTC
CTG
GTGGCCCACCTTGCCTTTCAGATATGCCTACACACCGTGCCTCACCTGGACCAGTTTCTGGGACAAA
AC
GGTAGCCTTTGGGTGAAGGTGTCTCAACACATAGGGGTTACGAGGCTGGACCTGAAGGACATCTTTAA
C
ACCACCAGGCTGGTAGCACCTGACCTGGGAGTGCTGCTGGCGTCCTCCCTTTGCCTTGGCCTCTGTGGA
CGC
CTCACGAGGAAAGCCCGGCAGAGTCGGCGCACCCAGGAGCTGGATGATGACGATGACGATGATGACG
AC
GATGAAGACATAGATGCTGCCCCAGCCGTGGGGCTGAAGGGAGCCCCTGCCCTGGCAACCAAACGCAG
G
CTGTGGCTGGCCTCCCGCTTCCGGGTCACGGCCCACTGGCTGCTGATGACCTCTGGACGGACGCTGGTC
ATT
GTGTTGCTGGCCCTGGCAGGCATAGCCCACCCTTCGGCCTTCTCCAGCGTCTACCTGGTGGTGTTCC
TG
GCCATCTGCACCTGGTGGTCCTGTCACTTTCCTCTCAGCCCCCTGGGCTTTAACACCCTCTGTGTCAT
G
GTGAGCTGTTTTGGTGCCGGCCATCTCATTTGCCTATACTGCTATCAGACACCATTTATCCAGGACATG
TTA
CCCCCTGGGAACATCTGGGCCAGGCTATTTGGTCTCAAGAACTTCGTAGACCTCCCTAACTACTCCA
GC
CCCAACGCCCTGGTACTCAACACTAAGCACGCCTGGCCCATCTATGTGAGTCCCGGAATCCTGCTGCT
G
CTATATTACACAGCCACCTCTCTCCTGAAGCTCCACAAGAGCTGTCCCTCAGAGCTGAGGAAGGAGACA
CCC
AGGGAGGATGAGGAGCATGAGCTGGAACTGGACCACCTGGAGCCAGAGCCCCAGGCTAGGGACGCCA
CC
CAGGGTGAGATGCCCATGACCACGGAACCTGACCTTGACAACTGCACCGTGCATGTACTAACCAGCCA
G
AGCCCTGTCCGCCAGCGTCCAGTTCGCCCCAGGCTGGCTGAGCTGAAAGAGATGTCACCGCTACATGGC
CTG
GGCCACCTCATCATGGACCAGAGCTATGTGTGTGCCCTGATTGCCATGATGGTGTGGAGCATCATGT
AC
CACAGCTGGCTGACCTTCGTCCTGCTGCTCTGGGCCTGCCTCATCTGGACGGTGCGTAGCCGCCACCA
G
CTGGCTATGCTCTGCTCGCCCTGCATCCTGCTGTATGGGCTGACGCTCTGCTGCCTGAGGTACGTGTGG
GCC
ATGGAACTTCCTGAGCTGCCCACCACCCTGGGCCCTGTCAGCCTGCACCAGTTGGGACTGGAACACA
CA
CGCTACCCTTGCCTGGACCTCGGTGCCATGCTCCTCTATCTGCTCACATTCTGGCTCCTTCTGCGTCA
G
TTCGTGAAGGAGAAGCTGCTGAAGAAGCAAAAGGTGCCTGCGGCGCTTTTGGAGGTCACGGTGGCCGAC
ACT
GAGCCCACACAGACCCAGACGCTGCTGCGGAGCCTGGGGGAGCTGGTCACCGGCATCTACGTCAAAT
AC
TGGATCTATGTGTGCGCCGGCATGTTCATTGTGGTCAGCTTCGCCGGCCGCCTGGTGGTCTACAAAAT
C
GTCTACATGTTCCTCTTCCTGCTGTGCCTCACCTTGTTCCAGGTCTACTACACCCTGTGGAGGAAGCTG
CTG
CGTGTCTTCTGGTGGCTCGTGGTGGCCTATACAATGCTCGTGCTCATCGCTGTGTACACCTTCCAGT
TC
CAGGACTTCCCCACCTATTGGCGCAACCTCACGGGCTTCACGGACGAGCAGTTGGGCGACCTGGGCCT
G
GAGCAGTTCAGTGTGTCGGAGCTCTTTTCCAGTATCCTCATCCCTGGCTTCTTCCTGCTGGCCTGCATC
CTG
CAGCTGCACTACTTCCACAGACCGTTCATGCAGCTCACTGACCTGGAGCACGTGCCGCCACCAGGCA
CC
CGCCACCCTCGATGGGCTCACAGGCAGGATGCAGTGAGCGAGGCCCCTCTGCTTGAGCATCAGGAGGA
A
GAGGAAGTCTTCAGGGAAGATGGGCAGAGCATGGATGGGCCCCACCAGGCCACACAGGTCCCTGAGGGT
ACG
GCCAGCAAGTGGGGCCTGGTGGCTGACCGGCTGCTGGACCTAGCGGCCAGCTTCTCGGCTGTCCTCA
CC
CGAATCCAGGTGTTCGTTCGGCGCTTGCTAGAACTTCACGTCTTCAAGCTGGTGGCCCTCTACACTGT
C
TGGGTGGCCCTGAAAGAAGTGTCTGTGATGAACCTGCTGCTGGTGGTGCTATGGGCCTTCGCCTTGCCC
TAT
CCGCGCTTCCGGCCCATGGCTTCCTGCCTGTCCACCGTGTGGACCTGTATCATCATTGTATGCAAGA
TG
CTCTATCAGCTCAAGATTGTCAACCCGCATGAGTACTCCAGCAACTGCACTGAGCCCTTCCCCAACAA
T
ACCAACTTGCAGCCTTTGGAGATCAACCAGTCTTTGCTGTACCGTGGCCCTGTTGACCCTGCCAACTGG
TTT
GGGGTGCGGAAGGGTTACCCCAACTTGGGCTATATCCAGAACCACCTGCAGATCCTTCTGTTGCTGG
TG
TTTGAGGCCGTGGTGTACCGGCGCCAAGAGCACTACCGCCGGCAGCACCAGCAGGCCCCTCTGCCCGC
C
CAGGCTGTGTGCGCAGATGGCACCCGCCAGAGGTTGGACCAGGACCTACTTAGCTGCCTCAAGTATTTC
ATC
AACTTCTTCTTCTACAAATTCGGGCTGGAGATCTGCTTCTTGATGGCCGTGAATGTGATTGGGCAGC
GT
ATGAACTTCATGGTGATCTTACACGGTTGCTGGTTGGTGGCCATCCTTACACGCCGGCGCCGTGAGGC
C
ATCGCCCGCCTCTGGCCTAACTACTGTCTGTTCCTCACGCTGTTCCTGCTGTACCAGTACCTGCTGTGT
TTG
GGCATGCCCCCTGCACTGTGCATTGACTATCCATGGCGCTGGAGCAAGGCCATCCCCATGAATTCCG
CC
CTCATCAAGTGGCTGTACCTACCTGACTTCTTCAGAGCCCCCAACTCCACCAACCTTATCAGTGACTT
C
CTCCTGCTGCTTTGCGCCTCCCAGCAGTGGCAGGTCTTCTCAGCGGAGCGAACGGAGGAGTGGCAACGC
ATG
GCGGGCATCAACACTGACCACCTGGAGCCCCTGCGTGGGGAGCCCAACCCTATACCCAACTTCATCC
AC
TGCAGGTCCTATCTGGATATGCTGAAGGTGGCCGTCTTCCGCTACCTGTTCTGGCTGGTGCTCGTTGT
G
GTGTTTGTTGCGGGGGCCACCCGCATAAGCATCTTCGGGCTGGGGTACCTGCTAGCCTGCTTCTACCTG
CTG
CTGTTTGGCACTACCCTGCTGCAGAAGGACACGCGAGCCCAGCTCGTGCTGTGGGACTGCCTCATCC
TC
TATAATGTCACTGTCATCATCTCTAAGAATATGCTGTCGCTCCTGTCCTGTGTCTTCGTGGAGCAAAT
G
CAGAGCAACTTCTGCTGGGTCATCCAGCTCTTCAGCCTCGTGTGCACAGTCAAAGGCTACTATGATCCC
AAA
GAGATGATGACCAGGGACCGGGACTGCCTGCTGCCTGTGGAGGAGGCCGGGATCATCTGGGACAGTA
TC
TGCTTCTTCTTCCTGCTCTTGCAACGGCGCATCTTTCTCAGCCACTACTTCCTGCATGTCAGCGCTGA
C
CTGAAAGCCACAGCCCTGCAGGCATCCAGGGGCTTTGCCCTCTACAATGCAGCCAACCTGAAGAGCATC
AAC
TTCCATCGCCAGATTGAGGAGAAGTCCCTGGCCCAGCTGAAAAGACAGATGAAGCGCATCCGTGCCA
AA
CAGGAGAAGTACAGGCAGAGCCAGGCAAGTCGTGGCCAACTCCAGTCCAAAGACCCTCAGGATCCCAG
C
CAGGAGCCAGGGCCTGACAGCCCAGGGGGCTCCTCCCCGCCACGGAGACAGTGGTGGCGCCCCTGGCTG
GAC
CACGCCACAGTCATCCACTCTGGCGACTACTTCCTGTTTGAGTCAGATAGCGAGGAGGAAGAGGAGG
CC
CTACCTGAGGACCCCAGGCCTGCAGCTCAGAGTGCCTTCCAGATGGCATACCAGGCATGGGTAACCAA
T
GCCCAGACAGTGCTGAGGCAGCGTCGGGAGCGGGCACGGCAGGAGCGGGCAGAGCAGCTGGCTTCTGGA
GGT
GACTTGAACCCAGATGTGGAACCAGTAGATGTCCCAGAAGATGAGATGGCAGGCCGTAGCCACATGA
TG
CAGCGTGTGCTAAGCACCATGCAGTTCCTGTGGGTGCTGGGCCAGGCCACGGTAGACGGGCTGACGCG
C
TGGCTGCGTGCATTCACGAAGCACCACCGCACCATGAGCGATGTGCTGTGCGCAGAGCGCTACCTGCTC
ACC
CAGGAGCTTCTTCGGGTTGGAGAGGTACGCCGAGGTGTGCTGGACCAGCTTTATGTGGGTGAAGATG
AG
GCCACATTGTCAGGTCCCATGGAGACCCGGGATGGACCCAGCACAGCCTCAAGTGGGCTGGGAGCCGA
A
GAGCCTTTGAGTAGCATGACAGACGACACCAGCAGCCCCCTGAGCACAGGCTATAACACCCGCAGTGGC
AGT
GAGGAGATTGTCACCGACGCTGGGGACCTCCAGGCTGGGACCTCCCTGCACGGCTCCCAAGAGCTTT
TA
GCCAATGCTCGTACCCGGATGCGCACGGCCAGCGAGCTGCTACTGGATAGGCGCCTGCATATCCCTGA
G
CTGGAGGAGGCCGAGCGGTTTGAGGCACAGCAGGGCCGGACTCTGCGGCTGCTCAGGGCTGGGTACCAG
TGC
GTGGCGGCACACTCGGAGCTGCTCTGTTACTTCATCATCATCCTTAACCACATGGTGACAGCCTCGG
CT
GCCTCCCTGGTGCTGCCCGTGCTTGTGTTCCTGTGGGCCATGCTGACCATCCCGAGGCCTAGCAAGCG
C
TTTTGGATGACAGCTATCGTCTTCACTGAGGTCATGGTGGTCACCAAATACCTGTTCCAGTTCGGCTTC
TTC
CCCTGGAACAGCTACGTTGTGCTGCGGCGCTATGAGAACAAGCCCTACTTCCCTCCGCGAATCCTGG
GC
CTTGAGAAAACGGACAGCTACATCAAGTATGACCTGGTGCAGCTCATGGCCCTCTTCTTCCACCGCTC
G
CAGCTACTGTGTTATGGCCTCTGGGACCATGAGGAGGATCGCTATCCCAAGGACCATTGCAGGAGTAGT
GTG
AAGGACCGGGAGGCCAAGGAAGAGCCAGAAGCTAAGCTGGAATCGCAGTCTGAGACAGGCACTGGGC
AT
CCCAAGGAGCCAGTGTTGGCCGGTACTCCCAGGGACCACATCCAAGGGAAAGGAAGTATTAGATCCAA
G
GATGTTATCCAAGATCCCCCAGAGGACCTTAAGCCCCGGCACACGAGGCACATCAGCATACGCTTCAGG
AGG
CGCAAGGAGACTCCAGGACCCAAAGGAACAGCAGTCATGGAGACTGAGCACGAGGAGGGAGAAGGAA
AA
GAAACTACAGAGAGAAAGAGGCCGCGTCACACTCAAGAAAAATCGAAGTTTCGGGAGAGAATGAAGGC
A
GCTGGGCGCCGGCTGCAGAGCTTCTGTGTGTCACTGGCCCAGAGCTTCTACCAACCCTTGCAGCGTTTC
TTC
CATGACATTCTGCACACAAAGTACCGGGCGGCCACCGACGTCTACGCCCTCATGTTCCTGGCCGATA
TT
GTCGACATCATCATCATCATCTTTGGTTTTTGGGCTTTTGGGAAGCACTCTGCAGCCACAGACATTGC
A
TCCTCGCTGTCAGATGACCAGGTGCCACAGGCCTTCCTGTTCATGCTGCTGGTCCAGTTTGGCACCATG
GTC
ATCGACCGTGCCCTCTACCTGCGCAAGACTGTCCTGGGAAAGCTGGCCTTTCAGGTGGTCCTGGTGG
TG
GCGATTCACATCTGGATGTTCTTTATCTTACCGGCTGTCACTGAGAGGATGTTCAGCCAGAATGCGGT
G
GCACAGCTGTGGTACTTCGTCAAGTGCATTTACTTTGCCCTGTCCGCCTACCAGATCCGCTGTGGCTAC
CCC
ACCCGTATCTTGGGCAACTTCCTCACCAAGAAATACAACCATCTAAACCTCTTCCTTTTCCAGGGGT
TC
CGTCTAGTGCCGTTCCTGGTGGAGCTGCGGGCCGTCATGGACTGGGTGTGGACCGACACCACGCTGTC
C
CTGTCCAACTGGATGTGTGTGGAAGACATCTATGCCAACATCTTTATCATCAAGTGCAGCCGAGAGACA
GAG
AAGAAATACCCCCAGCCCAAGGGGCAGAAGAAGAAGAAAATTGTCAAGTATGGTATGGGAGGCCTCA
TT
ATCCTCTTCCTCATCGCCATCATCTGGTTCCCTCTGCTCTTCATGTCACTGATCCGCTCTGTGGTCGG
G
GTCGTCAACCAGCCCATTGATGTCACCGTCACCCTCAAGCTAGGCGGCTATGAGCCACTGTTCACCATG
AGC
GCCCAGCAGCCATCCATTGTGCCATTCACACCCCAGGCCTACGAGGAGCTGTCCCAGCAGTTTGACC
CC
TATCCACTAGCCATGCAGTTCATTAGCCAGTACAGTCCTGAGGACATCGTCACTGCACAGATCGAGGG
C
AGCTCGGGGGCGCTGTGGCGCATCAGCCCACCCAGCCGAGCCCAGATGAAGCAGGAGCTGTACAACGGC
ACA
GCCGACATTACACTGCGCTTTACCTGGAATTTCCAAAGGGACCTGGCCAAGGGTGGCACTGTGGAGT
AT
ACTAATGAGAAGCACACCTTGGAGCTGGCCCCCAACAGTACGGCACGAAGGCAGCTGGCCCAACTGCT
C
GAGGGCAGACCTGACCAGTCAGTGGTCATTCCCCATCTCTTCCCCAAGTACATTCGTGCTCCCAATGGG
CCT
GAAGCCAACCCTGTGAAGCAGCTGCAGCCAGATGAGGAAGAGGACTACCTTGGTGTGCGCATCCAGC
TG
CGGAGGGAGCAAGTGGGCACAGGGGCCTCTGGGGAGCAAGCGGGCACCAAGGCCTCCGACTTCCTCGA
G
TGGTGGGTCATCGAGCTGCAGGACTGCAAGGCTGACTGCAACCTGCTGCCCATGGTCATCTTCAGTGAC
AAG
GTCAGCCCACCTAGCCTGGGCTTCCTGGCCGGCTACGGGATTGTGGGGCTGTACGTCTCCATCGTGC
TG
GTGGTTGGCAAGTTTGTGCGGGGCTTCTTCAGCGAGATCTCTCACTCCATCATGTTCGAGGAACTGCC
G
TGTGTGGACCGCATCCTCAAGCTGTGCCAGGACATCTTCTTGGTGCGCGAGACCCGGGAGCTGGAGCTG
GAG
GAGGAGCTATACGCCAAGCTCATCTTCCTGTACCGATCTCCAGAGACCATGATTAAGTGGACACGTG
AG
AGGGAGTAG


Translation (2546 aa):
MEPHVLGAGLYWLLLPCTLLAASLLRFNALSLVYLLFLLLLPWLPGPSRHSIPGHTGRLLRALLCLSLLF
L
VAHLAFQICLHTVPHLDQFLGQN
GSLWVKVSQHIGVTRLDLKDIFNTTRLVAPDLGVLLASSLCLGLCG
R
LTRKARQSRRTQEL
DDDDDDDDDDEDIDAAPAVGLKGAPALATKRRLWLASRFRVTAHWLLMTSGRTLV
I
VLLALA
GIAHPSAFSSVYLVVFLAICTWWSCHFPLSPLGFNTLCVMVSCFGAGHLICLYCYQTPFIQDM
L
PPGNIWA
RLFGLKNFVDLPNYSSPNALVLNTKHAWPIYVSPGILLLLYYTATSLLKLHKSCPSELRKET
P
REDEEHELELDHLEPEPQARDATQ
GEMPMTTEPDLDNCTVHVLTSQSPVRQRPVRPRLAELKEMSPLHG
L
GHLIMDQSYVCALIAMM
VWSIMYHSWLTFVLLLWACLIWTVRSRHQLAMLCSPCILLYGLTLCCLRYVW
A
MELPELPTTLGPVSLHQLGLEHTRYPCLDLGAM
LLYLLTFWLLLRQFVKEKLLKKQKVPAALLEVTVAD
T
EPTQTQTLLRSLGELVTGIYVKYWIYVCAGMFIVVSFAGRLVVYKIVYMFLFLLCLTLFQVYYTLWRKL
L
RVFWWLVVAYTMLVLIAVYTFQFQDFPTYWRNLTGFTDE
QLGDLGLEQFSVSELFSSILIPGFFLLACI
L
QLHYFHRPFMQLTDLEHVPPPGTRHPRWAH
RQDAVSEAPLLEHQEEEEVFREDGQSMDGPHQATQVPEG
T
ASKWGLVADRLLDLAASFSAVLTRIQVFVRRLLELHVFKLVALYTVWVALKE
VSVMNLLLVVLWAFALP
Y
PRFRPMASCLSTVWTCIIIVCKMLYQLKIVNPHEYSSNCTE
PFPNNTNLQPLEINQSLLYRGPVDPANW
F
GVRKGYPNLGYIQ
NHLQILLLLVFEAVVYRRQEHYRRQHQQAPLPAQAVCADGTRQRLDQDLLSCLKYF
I
NFFFYKFGLE
ICFLMAVNVIGQRMNFMVILHGCWLVAILTRRRREAIARLWPNYCLFLTLFLLYQYLLC
L
GMPPALCI
DYPWRWSKAIPMNSALIKWLYLPDFFRAPNSTNLISDFLLLLCASQQWQVFSAERTEEWQR
M
AGINTDHLEPLRGEPNPIPNFIHC
RSYLDMLKVAVFRYLFWLVLVVVFVAGATRISIFGLGYLLACFYL
L
LFGTTLLQKDTRAQLVLWDCLILYNVTVIISKNMLS
LLSCVFVEQMQSNFCWVIQLFSLVCTVKGYYDP
K
EMMTRDRDCLLPVEEAGIIWDSICFFFLLLQRRIFLSHYFLHVSADLKATALQAS
RGFALYNAANLKSI
N
FHRQIEEKSLAQLKR
QMKRIRAKQEKYRQSQASRGQLQSKDPQDPSQEPGPDSPGGSSPPRRQWWRPWL
D
HAT
VIHSGDYFLFESDSEEEEEALPEDPRPAAQSAFQMAYQAWVTNAQTVLRQRRERARQERAEQLASG
G
DLNPDVEPVDVPEDEMA
GRSHMMQRVLSTMQFLWVLGQATVDGLTRWLRAFTKHHRTMSDVLCAERYLL
T
QELLR
VGEVRRGVLDQLYVGEDEATLSGPMETRDGPSTASSGLGAEEPLSSMTDDTSSPLSTGYNTRSG
S
EEIVTDAGDLQAGTSLHGSQELLANARTRMRTASELLLD
RRLHIPELEEAERFEAQQGRTLRLLRAGYQ
C
VAAHSELLCYFIIILNHMVTASAASLVLPVLVFLWAMLTIPRPSKRFWMTAIVFTE
VMVVTKYLFQFGF
F
PWNSYVVLRRYENKPYFPPRILGLEKTDSYIKYDLVQLMALFFHRSQLL
CYGLWDHEEDRYPKDHCRSS
V
KDREAKEEPEAKLESQSETGTGHPKEPVLAGTPRDHIQGKGSIRSKDVIQDPPEDLKPRHTRHISIRFR
R
RKETPGPKGTAVM
ETEHEEGEGKETTERKRPRHTQEKSKFRERMKAAGRRLQSFCVSLAQSFYQPLQRF
F
HDILHTKYRAATDVYALMFLADIVDIIIIIFGFWAFG
KHSAATDIASSLSDDQVPQAFLFMLLVQFGTM
V
IDRALYLRKTVLGKLAFQVVLVVAIHIWMFFILPAVTE
RMFSQNAVAQLWYFVKCIYFALSAYQIRCGY
P
TRILGNFLTKKYNHLNLFLFQ
GFRLVPFLVELRAVMDWVWTDTTLSLSNWMCVEDIYANIFIIKCSRET
E
K
KYPQPKGQKKKKIVKYGMGGLIILFLIAIIWFPLLFMSLIRSVVGVVNQPIDVTVTLKLGGYEPLFTM
S
AQQPSIVPFTPQAYEELSQQFDPYP
LAMQFISQYSPEDIVTAQIEGSSGALWRISPPSRAQMKQELYNG
T
ADITLRFTWNFQ
RDLAKGGTVEYTNEKHTLELAPNSTARRQLAQLLEGRPDQSVVIPHLFPKYIRAPNG
P
EANPVKQLQP
DEEEDYLGVRIQLRREQVGTGASGEQAGTKASDFLEWWVIELQDCKADCNLLPMVIFSD
K
VSPPSLGFLAGY
GIVGLYVSIVLVVGKFVRGFFSEISHSIMFEELPCVDRILKLCQDIFLVRETRELEL
E
EELYAKLIFLYRSPETMIKWTRERE




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser