NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS52593.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
52593.1 Public Mus musculus 8 Olfr373 21 106 86 CCDS HistoryNCBI Gene:258532Re-query CCDS DB by CCDS ID:52593.1Re-query CCDS DB by GeneID:258532See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 52593.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000074540 ENSMUSP00000074128 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000074540Link to Ensembl Protein Viewer:ENSMUSP00000074128Re-query CCDS DB by Nucleotide ID:ENSMUST00000074540Re-query CCDS DB by Protein ID:ENSMUSP00000074128
Original member Current member EBI,WTSI OTTMUST00000149288 OTTMUSP00000077469 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000149288Link to Vega Protein Viewer:OTTMUSP00000077469Re-query CCDS DB by Nucleotide ID:OTTMUST00000149288Re-query CCDS DB by Protein ID:OTTMUSP00000077469
Original member Current member NCBI NM_146539.2 NP_666750.2 Accepted alive Link to Nucleotide Sequence:NM_146539.2Link to Protein Sequence:NP_666750.2Re-query CCDS DB by Nucleotide ID:NM_146539Re-query CCDS DB by Protein ID:NP_666750Link to BLAST:NP_666750.2

Chromosomal Locations for CCDS 52593.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 8 (NC_000074.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 72099762 72100706 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (945 nt):
ATGGGGACTTCAAATGTGTCATCAAATTCAGATTTCATCCTCATGGGGCTCTTCAGCTACACAGGGCCCC
AT
CTTGTCCTGTTCTTCCTCATGGCCACCGTGTTCATCATTGGCCTGCTAGGCAACACCACCCTGCTTTT
T
CTGATTGCCACAGACTCCAGGCTCCACACACCCATGTACTTCCTGCTCAGCCAACTCTCACTTCTGGAT
GTC
GGCTTCCCACTGGTTACCATCCCCAAAGTGGTGGCTGAGTTCCTGCAAGGACAGAATGTCATAAGCT
TT
GGGGGATGTGCCACTCAGATGTTCTTCCTCATGCTCATGGGTGTCTCTGAGGGTGTCCTTCTGTCCCT
C
ATGTCTTATGACCGCTACGTGGCCGTATGCCACCCCCTGCACTACCAGGTGCTCATGAGAAACCAAGTG
TGT
CTGGTGATGGTGGGTGCATCCTGGTTCTCAGGTGCCTTGGTGGCCTCCATCCTGACCTCCATCACCC
TG
CAGTTCCCCTACTGTGCCTCACACACCGTGGACCACTTCTTCTGTGAGATGCCAGCTCTCCTCAAGCT
G
TCATGTGCAGACACATCAGCCTATGAGTTGGCGCTCTCCATCTCTGGGGTGCTGATCTTACTGCTACCC
CTG
TCTCTCATCTTCATTTCCTACGGCCACGTTCTGGGAGCTGTCCTGCTCATGCGGTCAGCTGAAGCTA
GA
CACAAGGCTTTCACCACGTGCTCCTCACATGTGACTGTAGTGGGTCTCTTTTTTGGGGCAGCTGTATT
C
ATATACATGGTCCCAGGCAGCTACCACAGCCCAAAACAGGATAATGTGGTATCCCTCTTCTACAGCCTC
ATC
ACCCCTACCCTCAACCCCCTCATCTACAGCTTGAGAAACAGAGAAGTTCGAATGTCCTTGGTCAAGT
TC
ATGGGCAGGTCTGACTTCAAGGTGAAGGGATGA


Translation (314 aa):
MGTSNVSSNSDFILMGLFSYTGPHLVLFFLMATVFIIGLLGNTTLLFLIATDSRLHTPMYFLLSQLSLLD
V
GFPLVTIPKVVAEFLQGQNVISFGGCATQMFFLMLMGVSEGVLLSLMSYDRYVAVCHPLHYQVLMRNQV
C
LVMVGASWFSGALVASILTSITLQFPYCASHTVDHFFCEMPALLKLSCADTSAYELALSISGVLILLLP
L
SLIFISYGHVLGAVLLMRSAEARHKAFTTCSSHVTVVGLFFGAAVFIYMVPGSYHSPKQDNVVSLFYSL
I
TPTLNPLIYSLRNREVRMSLVKFMGRSDFKVKG




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser