NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS52576.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
52576.1 Public Mus musculus 8 Fkbp8 21 106 86 CCDS HistoryNCBI Gene:14232Re-query CCDS DB by CCDS ID:52576.1Re-query CCDS DB by GeneID:14232See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 52576.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000119353 ENSMUSP00000112527 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000119353Link to Ensembl Protein Viewer:ENSMUSP00000112527Re-query CCDS DB by Nucleotide ID:ENSMUST00000119353Re-query CCDS DB by Protein ID:ENSMUSP00000112527
Original member Current member EBI,WTSI OTTMUST00000077187 OTTMUSP00000040762 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000077187Link to Vega Protein Viewer:OTTMUSP00000040762Re-query CCDS DB by Nucleotide ID:OTTMUST00000077187Re-query CCDS DB by Protein ID:OTTMUSP00000040762
Original member Current member NCBI NM_010223.2 NP_034353.2 Accepted alive Link to Nucleotide Sequence:NM_010223.2Link to Protein Sequence:NP_034353.2Re-query CCDS DB by Nucleotide ID:NM_010223Re-query CCDS DB by Protein ID:NP_034353Link to BLAST:NP_034353.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_034353.2 402 O35465-1 402 100% 0 0

Chromosomal Locations for CCDS 52576.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 8 (NC_000074.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 70529414 70529675 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 70530940 70531109 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 70531185 70531273 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 70531525 70531742 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 70532577 70532749 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 70534117 70534194 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 70534483 70534614 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 70534867 70534953 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1209 nt):
ATGGCGTCTTGGGCTGAGCCCTCTGAGCCTGCTGCCCTGCGACTTCCTGGGGCCCCACTGCTGGAGGGCT
TT
GAGGTGCTCGATGGGGTTGATGATGCAGAGGAGGAAGATGACCTAAGTGGGCTGCCACCACTAGAGGA
C
ATGGGACAGCCTACAGTGGAGGAGGCTGAGCAGCCTGGAGCCCTGGCTCGGGAGTTCCTGGCAGCCACA
GAG
CCTGAGCCAGCCCCAGCCCCAGCCCCGGAAGAGTGGCTGGACATTCTGGGGAACGGATTGCTGCGGA
TG
AAGACACTGGTCCCAGGCCCGAAAGGCTCTAGCCGCCCACTCAAGGGCCAGGTGGTGACCGTTCACCT
G
CAGATGTCCCTGGAGAATGGCACCCGTGTACAGGAAGAGCCTGAACTGGCCTTCACGCTGGGAGACTGC
GAT
GTTATCCAGGCCCTGGACCTCAGTGTCCCGCTCATGGATGTGGGCGAGACAGCCATGGTTACCGCTG
AC
TCCAAGTACTGCTACGGCCCCCAGGGCAGGAGCCCATACATCCCCCCCCACGCAGCCCTGTGCCTGGA
A
GTCACCCTGAAGACGGCAGAGGATGGACCCGACCTGGAGATGCTGAGTGGGCAGGAGCGCGTGGCCCTG
GCC
AACCGCAAGCGGGAGTGTGGCAATGCCCACTACCAGCGTGCCGACTTTGTGCTGGCCGCCAATTCCT
AT
GACCTGGCCATCAAGGCTATCACCTCCAACACCAAAGTGGACATGACTTGTGAGGAGGAAGAGGAGCT
G
CTACAGCTGAAGGTCAAGTGTCTGAACAACCTTGCGGCCTCACAGCTGAAGCTGGACCACTACCGAGCA
GCT
CTGCGCTCCTGTAGCCAGGTGCTGGAGCACCAGCCGGACAACATCAAGGCACTGTTCCGCAAGGGCA
AG
GTGCTGGCTCAGCAAGGTGAATATAGTGAGGCCATCCCAATCCTGAGGGCTGCCCTGAAGCTGGAACC
T
TCCAACAAGACGATCCACGCAGAGCTCTCAAAGCTGGTAAAGAAGCGTGCTGCACAGCGGAGCACAGAG
ACC
GCCCTGTACCGAAAGATGCTAGGCAACCCCAGCCGGCTGCCTGCCAAGTGTCCGGGAAAGGGGGCCT
GG
TCCATCCCGTGGAAATGGCTGTTTGGGGCGACTGCCGTGGCCCTGGGGGGCGTGGCTCTCTCTGTGGT
C
ATTGCTGCCAGGAACTGA


Translation (402 aa):
MASWAEPSEPAALRLPGAPLLEGFEVLDGVDDAEEEDDLSGLPPLEDMGQPTVEEAEQPGALAREFLAAT
E
PEPAPAPAPEEWLDIL
GNGLLRMKTLVPGPKGSSRPLKGQVVTVHLQMSLENGTRVQEEPELAFTLGDC
D
VIQ
ALDLSVPLMDVGETAMVTADSKYCYGPQGRSPYIPPHAALCLEVTLKTAEDGPDLEMLSGQERVAL
A
NRKRECGNAHYQRADFVLAANSYDLAIKAITSNTK
VDMTCEEEEELLQLKVKCLNNLAASQLKLDHYRA
A
LRSCSQVLEHQPDNIKALFRKGK
VLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLVKKRAAQRSTE
T
ALYRKMLGNPSRLPAKCPGKGAW
SIPWKWLFGATAVALGGVALSVVIAARN



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser