NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS52244.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
52244.1 Public Mus musculus 7 Slc17a7 21 106 86 CCDS HistoryNCBI Gene:72961Re-query CCDS DB by CCDS ID:52244.1Re-query CCDS DB by GeneID:72961See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 52244.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000085374 ENSMUSP00000082489 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000085374Link to Ensembl Protein Viewer:ENSMUSP00000082489Re-query CCDS DB by Nucleotide ID:ENSMUST00000085374Re-query CCDS DB by Protein ID:ENSMUSP00000082489
Original member Current member EBI,WTSI OTTMUST00000144033 OTTMUSP00000075092 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000144033Link to Vega Protein Viewer:OTTMUSP00000075092Re-query CCDS DB by Nucleotide ID:OTTMUST00000144033Re-query CCDS DB by Protein ID:OTTMUSP00000075092
Original member Current member NCBI NM_182993.2 NP_892038.2 Accepted alive Link to Nucleotide Sequence:NM_182993.2Link to Protein Sequence:NP_892038.2Re-query CCDS DB by Nucleotide ID:NM_182993Re-query CCDS DB by Protein ID:NP_892038Link to BLink:NP_892038.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_892038.2 560 Q3TXX4 560 100% 0 0

Chromosomal Locations for CCDS 52244.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 7Link to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 45164083 45164144 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 45168715 45168967 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 45169817 45169935 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 45170210 45170324 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 45170401 45170488 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 45170660 45170746 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 45170847 45170989 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 45171775 45171924 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 45172058 45172190 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 45172892 45173002 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 45173362 45173489 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 45174751 45175044 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1683 nt):
ATGGAGTTCCGGCAGGAGGAGTTTCGGAAGCTGGCGGGGCGCGCCCTGGGGAGGCTGCACCGGTTACTGG
AG
AAGCGGCAGGAAGGCGCGGAGACACTGGAGCTGAGTGCCGACGGGCGGCCAGTGACCACGCACACTCG
G
GACCCGCCTGTGGTGGACTGCACCTGCTTTGGCCTCCCTCGTCGCTACATCATCGCCATCATGAGCGGT
CTG
GGTTTCTGTATCAGCTTTGGCATCCGCTGCAACCTGGGCGTGGCCATCGTGTCCATGGTCAACAACA
GC
ACAACCCACCGTGGGGGCCACGTGGTGGTGCAGAAAGCCCAGTTCAACTGGGATCCAGAGACTGTCGG
C
CTCATACATGGCTCCTTTTTCTGGGGCTACATTGTCACTCAGATTCCTGGAGGATTTATCTGCCAAAAA
TTC
GCAGCCAACAGGGTCTTTGGCTTTGCCATTGTGGCTACCTCCACCCTAAACATGTTGATCCCTTCAG
CA
GCCCGCGTTCACTATGGCTGTGTCATCTTCGTGAGGATCCTTCAGGGATTGGTGGAGGGGGTCACATA
C
CCTGCTTGCCATGGCATCTGGAGCAAATGGGCCCCTCCCTTAGAACGGAGTCGGCTGGCAACGACAGCC
TTT
TGCGGTTCCTATGCTGGGGCGGTGGTTGCCATGCCCTTGGCTGGGGTCCTTGTGCAGTATTCAGGAT
GG
AGTTCTGTCTTCTATGTCTATGGCAGCTTCGGGATCTTTTGGTACCTGTTCTGGTTGCTTGTCTCCTA
T
GAGTCACCGGCACTGCACCCCAGCATCTCTGAGGAGGAGCGCAAATACATTGAGGATGCCATCGGGGAG
AGC
GCCAAGCTCATGAACCCTGTTACGAAGTTTAACACACCCTGGAGGCGCTTCTTTACGTCCATGCCCG
TC
TATGCCATCATCGTTGCGAACTTTTGCCGCAGCTGGACCTTCTACCTGCTCCTCATCTCTCAGCCCGC
C
TACTTTGAAGAAGTGTTCGGCTTTGAGATCAGCAAGGTGGGGCTGGTGTCGGCGCTGCCTCACCTTGTC
ATG
ACCATCATCGTACCCATTGGAGGCCAGATCGCTGACTTTTTGCGCAGTCGTCACATAATGTCCACTA
CC
AACGTGCGAAAGCTCATGAACTGCGGGGGTTTCGGGATGGAAGCCACGCTGCTGCTGGTGGTCGGATA
C
TCGCACTCCAAGGGCGTGGCCATCTCCTTCCTGGTCCTGGCTGTGGGCTTCAGTGGCTTTGCCATCTCT
G
GG
TTTAACGTGAACCACTTGGACATCGCCCCTCGCTATGCCAGCATCTTGATGGGCATTTCCAATGGCG
TG
GGCACACTGTCTGGGATGGTGTGCCCCATCATCGTGGGTGCAATGACCAAGCACAAGACGCGGGAGGA
G
TGGCAGTACGTGTTCCTCATAGCCTCCCTGGTGCACTACGGCGGTGTCATCTTCTATGGGGTCTTTGCT
TCG
GGAGAGAAGCAGCCGTGGGCAGAGCCGGAGGAGATGAGCGAGGAGAAGTGTGGCTTTGTTGGCCACG
AC
CAGCTGGCTGGCAGTGACGAAAGTGAAATGGAGGACGAGGCTGAGCCCCCAGGGGCGCCCCCCGCGCC
G
CCTCCGTCCTACGGGGCCACACACAGCACAGTGCAGCCTCCGAGGCCCCCGCCCCCTGTCCGGGACTAC
TGA


Translation (560 aa):
MEFRQEEFRKLAGRALGRLHRLLEKRQEGAETLELSADGRPVTTHTRDPPVVDCTCFGLPRRYIIAIMSG
L
GFCISFGIRCNLGVAIVSMVNNSTTHRGGHVVVQ
KAQFNWDPETVGLIHGSFFWGYIVTQIPGGFICQK
F
AAN
RVFGFAIVATSTLNMLIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTA
F
C
GSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGE
S
AKLMNPVT
KFNTPWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLV
M
TIIVPIGGQIADFLRSRHIMSTTNVRKLMNCG
GFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAIS
G
FNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHKTREEWQYVFLIASLVHYGGVIFYGVFA
S
GEKQPWAEPEEMSEEKCGFVGHDQLAGSDESEMEDEAEPPGAPPAPPPSYGATHSTVQPPRPPPPVRDY




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser