NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS52235.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
52235.1 Public Mus musculus 7 Izumo2 21 106 86 CCDS HistoryNCBI Gene:75510Re-query CCDS DB by CCDS ID:52235.1Re-query CCDS DB by GeneID:75510See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 52235.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000085422 ENSMUSP00000082543 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000085422Link to Ensembl Protein Viewer:ENSMUSP00000082543Re-query CCDS DB by Nucleotide ID:ENSMUST00000085422Re-query CCDS DB by Protein ID:ENSMUSP00000082543
Original member Current member EBI,WTSI OTTMUST00000144208 OTTMUSP00000075199 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000144208Link to Vega Protein Viewer:OTTMUSP00000075199Re-query CCDS DB by Nucleotide ID:OTTMUST00000144208Re-query CCDS DB by Protein ID:OTTMUSP00000075199
Original member NCBI NM_029317.1 NP_083593.1 Updated not alive Link to Nucleotide Sequence:NM_029317.1Link to Protein Sequence:NP_083593.1Re-query CCDS DB by Nucleotide ID:NM_029317Re-query CCDS DB by Protein ID:NP_083593
Current member NCBI NM_029317.2 NP_083593.1 Accepted alive Link to Nucleotide Sequence:NM_029317.2Link to Protein Sequence:NP_083593.1Re-query CCDS DB by Nucleotide ID:NM_029317Re-query CCDS DB by Protein ID:NP_083593Link to BLAST:NP_083593.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_083593.1 193 Q9DA16-2 193 100% 0 0

Chromosomal Locations for CCDS 52235.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 44708743 44708974 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 44709056 44709130 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 44710255 44710341 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 44710511 44710531 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 44715328 44715451 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 44719743 44719785 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (582 nt):
ATGCCTTTGGCCTTGGCCCTGGTGCTTTTGTGTGGCCTGGGCGGCCCCGGGGCATGGGGCTGCCTGCAGT
GC
GACCAGTCAGTGCTACTGGAGCTCAGGCAGTTGCGTGATGCCATCGTCACCAAGCGCTTCCATCTGGA
A
GGGCTGCAGGCGCGCGCGCAGGCCCTGCTGTTGAGCATGGAGGGGCCTTTCTTCAGGGACTATGCAATG
AAC
GCTTTCGTGGGGAAAGTGGTCGTGGATCAACTGGAAAAAGTGGCGACATCCTTCAAGAACCAAGCCC
AG
TATATAAAGGCTAACTCTAAGACAGACGTTCCTCTGCTGGAAGAGCTGGTGAGCTTCAGGGAACATGC
C
ATCAAGGAACTAAAGGGAGCATTAAGAGACTATGAAATGAAAGCCTGTGACCACAAAACTTGTCAGGAT
GGG
CAGTTCCGCATGACTCTGAAGTTCCAGGACGACAACAAACCAAGGAACATGGTATTGGTGGGAGACT
TG
GTGACTGTAGGATTGGCCATCCTAACCTTCTTGGTCATCCTGATTGCGGCTTGTACCTACAGGCAAAA
C
CGGAAACTCCTGCTGAAGTAG


Translation (193 aa):
MPLALALVLLCGLGGPGAWGCLQCDQSVLLELRQLRDAIVTKRFHLEGLQARAQALLLSMEGPFFRDYAM
N
AFVGKV
VVDQLEKVATSFKNQAQYIKANSKTDVPLLEELVSFREHAIKELKGALRDYEMKACDHKTCQD
G
QFRMTLKFQDDNKPRNMVLVGDLVTVGLAILTFLVILI
AACTYRQNRKLLLK



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser