NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS52153.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
52153.1 Public Mus musculus 7 Ceacam2 21 106 86 CCDS HistoryNCBI Gene:26367Re-query CCDS DB by CCDS ID:52153.1Re-query CCDS DB by GeneID:26367See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 52153.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000044547 ENSMUSP00000048118 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000044547Link to Ensembl Protein Viewer:ENSMUSP00000048118Re-query CCDS DB by Nucleotide ID:ENSMUST00000044547Re-query CCDS DB by Protein ID:ENSMUSP00000048118
Original member Current member EBI,WTSI OTTMUST00000143089 OTTMUSP00000074614 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000143089Link to Vega Protein Viewer:OTTMUSP00000074614Re-query CCDS DB by Nucleotide ID:OTTMUST00000143089Re-query CCDS DB by Protein ID:OTTMUSP00000074614
Original member Current member NCBI NM_001113368.1 NP_001106839.1 Accepted alive Link to Nucleotide Sequence:NM_001113368.1Link to Protein Sequence:NP_001106839.1Re-query CCDS DB by Nucleotide ID:NM_001113368Re-query CCDS DB by Protein ID:NP_001106839Link to BLAST:NP_001106839.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001106839.1 520 Q925P2-1 520 100% 0 0

Chromosomal Locations for CCDS 52153.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 25518066 25518185 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 25519159 25519190 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 25519963 25520015 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 25520814 25520931 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 25527741 25528016 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 25529750 25530004 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 25530471 25530755 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 25538574 25538933 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 25539701 25539764 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1563 nt):
ATGGAGCTGGCCTCAGCACATCTCCACAAAGGGCAGGTTCCCTGGTTTGGACTACTGCTCACAGCCTCAC
TT
TTAGCCTCCTGGAGCCCTCCCACCACTGCACAAGTGACTGTTATGGCTTTTCCACTCCACGCTGCTGA
A
GGCAACAATGTTATTCTAGTTGTTTACAATATGATGAAGGGAGTCTCGGCCTTTAGCTGGCACAAGGGA
TCT
ACTACGTCTACAAATGCTGAAATTGTACGATTTGTAACAGGCACTAATAAGACTATAAAAGGGCCTG
TA
CACAGTGGCAGAGAGACACTATACAGCAATGGATCCCTGCTCATCCAAAGGGTCACCATGAAGGATAC
G
GGAGTCTACACAATAGAAATGACAGATCAAAACTATCGTCGTAGGGTCCTGACTGGACAATTTCATGTA
CAC
ACCCTATTACTAAAGTCCAACATCACAAGCAACAACTCCAATCCCGTAGAGGGTGACGACTCCGTAT
CA
TTAACCTGTGACTCTTACACTGACCCTGATAATATAACCTACCTGTGGAGCAGAAATGGTGAAAGCCT
T
TCAGAAGGTGACAGGCTGAAGCTGTCTGAGGGCAACAGGACTCTCACTTTACTCAATGTCACGAGGAAT
GAC
ACAGGACCCTATGTGTGTGAAACCCGGAACCCAGTGAGTGTCAACCGAAGTGACCCATTCAGCCTGA
AC
ATTATCTATGGTCCGGACACCCCGATTATATCCCCCTCAGATATTTATTTGCATCCAGGGTCAAACCT
C
AACCTCTCCTGCCATGCAGCCTCTAACCCACCTGCACAGTACTTTTGGCTTATCAATGAGAAGCCCCAT
GCA
TCCTCCCAAGAGCTCTTTATCCCCAACATCACTACTAATAATAGCGGAACCTATACCTGCTTCGTCA
AT
AACTCTGTCACTGGCCTCAGTAGGACCACAGTCAAGAACATTACAGTCCTTGAGCCAGTGACTCAGCC
C
TCCCTCCAAGTCACCAACACCACAGTCAAAGAACTAGACTCTGTCACCCTGACCTGCTTGTCGAAAGAC
CGT
CAAGCCCACATCCATTGGATCTTCAACAATGATACTCTTCTAATCACAGAGAAGATGACAACCTCTC
AG
GCGGGACTCATCCTCAAAATAGACCCTATTAAGAGGGAAGATGCCGGCGAGTATCAGTGTGAAATCTC
G
AATCCAGTCAGCGTCAAGAGGAGCAACTCAATCAAACTGGAAGTAATATTTGACTCAACATATGACATT
TCA
GATGTCCCCATTGCTGTAATCATAACTGGAGCTGTGGCCGGGGTGATTCTAATAGCAGGGCTGGCAT
AT
CGCCTCTGTTCCAGGAAGTCTCGCTGGGGAAGTGACCAGCGAGATCTCACAGAGCACAAACCCTCAGC
C
TCCAACCACAATCTGGCTCCTTCTGACAACTCTCCTAACAAGGTGGATGACGTCGCATACACTGTCCTG
AAC
TTCAATTCCCAGCAACCCAACCGGCCAACTTCAGCCCCTTCTTCTCCAAGAGCCACAGAAACAGTTT
AT
TCAGAAGTAAAAAAGAAGTGA


Translation (520 aa):
MELASAHLHKGQVPWFGLLLTASLLASWSPPTTAQVTVMAFPLHAAEGNNVILVVYNMMKGVSAFSWHKG
S
TTSTNAEIVRFVTGTNKTIKGPVHSGRETLYSNGSLLIQRVTMKDTGVYTIEMTDQNYRRRVLTGQFHV
H
TLLLKSNITSNNSNPVEGDDSVSLTCDSYTDPDNITYLWSRNGESLSEGDRLKLSEGNRTLTLLNVTRN
D
TGPYVCETRNPVSVNRSDPFSLNII
YGPDTPIISPSDIYLHPGSNLNLSCHAASNPPAQYFWLINEKPH
A
SSQELFIPNITTNNSGTYTCFVNNSVTGLSRTTVKNITVL
EPVTQPSLQVTNTTVKELDSVTLTCLSKD
R
QAHIHWIFNNDTLLITEKMTTSQAGLILKIDPIKREDAGEYQCEISNPVSVKRSNSIKLEVI
FDSTYDI
S
DVPIAVIITGAVAGVILIAGLAYRLCSRKSR
WGSDQRDLTEHKPSASNHNLAPSDNSPNKVDDVAYTVL
N
FNSQQPNRPTSAPSSPRATETVYSEVKKK




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser