NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS52052.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
52052.1 Public Mus musculus 7 Rsph6a 21 106 86 CCDS HistoryNCBI Gene:83434Re-query CCDS DB by CCDS ID:52052.1Re-query CCDS DB by GeneID:83434See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 52052.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000076887 ENSMUSP00000076153 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000076887Link to Ensembl Protein Viewer:ENSMUSP00000076153Re-query CCDS DB by Nucleotide ID:ENSMUST00000076887Re-query CCDS DB by Protein ID:ENSMUSP00000076153
Original member Current member EBI,WTSI OTTMUST00000054445 OTTMUSP00000025984 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000054445Link to Vega Protein Viewer:OTTMUSP00000025984Re-query CCDS DB by Nucleotide ID:OTTMUST00000054445Re-query CCDS DB by Protein ID:OTTMUSP00000025984
Original member Current member NCBI NM_001159671.1 NP_001153143.1 Accepted alive Link to Nucleotide Sequence:NM_001159671.1Link to Protein Sequence:NP_001153143.1Re-query CCDS DB by Nucleotide ID:NM_001159671Re-query CCDS DB by Protein ID:NP_001153143Link to BLAST:NP_001153143.1

Chromosomal Locations for CCDS 52052.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 19054745 19055373 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 19057537 19057768 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 19067089 19067233 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 19068034 19068151 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 19074038 19074275 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1362 nt):
ATGGGGGAACCACCGCCCAATCCTGACCCCTCTCAAACCCGGAGGGCTTCCCAAGGCTCAGAAAGGGCAC
GG
AGTCAAGAGTACTCTCAGCCTCTGTTAACCATCCCAGAGGATGGGTTGAACCGACCACCTCCGCAGCG
G
GGCAGTCGGAGCAGTCAGGGCAGTCAGGACCTGCAGGGAACTGGTCTACCCCACTGGCCACAGAGGTCC
AGC
CTGGTCCCAGATGTTCAAGGTGATGAAGGCACCGAGTACCACCAGTCCATGCCCTTAGGCTACACGC
CA
GGCTTTCCCATGGAGTTCTCGCAACAGGGTTACCTGGATGATAGCAGGATGATGGAGCAGTTCCCACA
G
GGCCAGGACCTCTTAGAACAACTGGAGTCTACCTACCAAGGCTCGGCTTCTGGAATCCTGGGCCAGCTC
AAC
TTGTATCCAAGAGAGGATGAGATATTCAGCCAGGACACACAGCACGGACCCTACCTGAGAGACGACC
CC
TCCCTCCACCTGAGGCCCTCTGACCTGGGCTTCATGCCCATTGTTGGAGAGGTACCTGACCCCGAGCC
T
CGTGAGCTGGCAATACAGAACGCCAAGGCCTACCTGCTGCGGACCAGCATGAGCTGCAACCTCAGCCTG
TAT
GAGCACCTGGTGAACCTGCTGACCAAGATCCTGAACCAGCGCCCTGAGGACCCCTTGTCCATCCTGG
AG
TCTCTGAACCGCACCATGCAGTGGGAATGGTTTCACCCCAAGCTGGACACGCTGCGGGACGACCCCGA
G
ATGCAGCCCACCTACGAGATGGCCGAAAAGCAAAAGGCTCTGTTTATCAGGGGTGGAGGAGAAGGCGAA
CAG
GAAATGGAAGAGGAGGTGGGGCGCTGTACATGGGTGAACCCACTGCAGAAAACAGAGGAGGAAGAAG
AG
CTAGGGGAGGAGGAAGAGAAGGCAGACGAGGCAATGGAGGAGGTGGAGCAGGAGGTCGGTCCTCCGCT
T
CTGACTCCGCTCTCAGAAGATGCAGAAATCATGCACCTGTCGCCCTGGACCACCCGCCTCTCCTGCAGC
CTC
AGCCCTCAGTACTCGGTGGCCATCGTGCGCTCCAACCTCTGGCCAGGGGCCTATGCCTACGCCACTG
GC
AAGAAGTTTGAGAACATATACATTGGCTGGGGTCACAAGTATAGCCCCGAGAACTTCAACCCAATGCT
G
CCAGCTCTGATTCAGCAAGAGTACCCCAGCGGCCCCGAAATCACGGAGATGAGTGACCCCACAGTGGAG
GAG
GAGCAGGCCCTGAAGGCTGCTCAGGAGCAGGCCCTGGCAGCCGCTGAGGAAGAGGAGGAAGATGAGG
AA
GAGGAGGAGGATGAAGACCTGGAGGACTGA


Translation (453 aa):
MGEPPPNPDPSQTRRASQGSERARSQEYSQPLLTIPEDGLNRPPPQRGSRSSQGSQDLQGTGLPHWPQRS
S
LVPDVQGDEGTEYHQSMPLGYTPGFPMEFSQQGYLDDSRMMEQFPQGQDLLEQLESTYQGSASGILGQL
N
LYPREDEIFSQDTQHGPYLRDDPSLHLRPSDLGFMPIVGEVPDPEPRELAIQNAKAYLLRTSMSCNLS
L
Y
EHLVNLLTKILNQRPEDPLSILESLNRTMQWEWFHPKLDTLRDDPEMQPTYEMAEKQKALFIRGGGEGE
Q
EMEEEV
GRCTWVNPLQKTEEEEELGEEEEKADEAMEEVEQEVGPPLLTPLSEDAEIMHLSPWTTRLSCS
L
SPQYSVAIVRSNLWPGAYAYATG
KKFENIYIGWGHKYSPENFNPMLPALIQQEYPSGPEITEMSDPTVE
E
EQALKAAQEQALAAAEEEEEDEEEEEDEDLED




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser