NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS51966.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
51966.1 Public Mus musculus 7 Tsen34 21 106 86 CCDS HistoryNCBI Gene:66078Re-query CCDS DB by CCDS ID:51966.1Re-query CCDS DB by GeneID:66078See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 51966.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000108629 ENSMUSP00000104269 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000108629Link to Ensembl Protein Viewer:ENSMUSP00000104269Re-query CCDS DB by Nucleotide ID:ENSMUST00000108629Re-query CCDS DB by Protein ID:ENSMUSP00000104269
Original member Current member EBI,WTSI OTTMUST00000055497 OTTMUSP00000026577 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000055497Link to Vega Protein Viewer:OTTMUSP00000026577Re-query CCDS DB by Nucleotide ID:OTTMUST00000055497Re-query CCDS DB by Protein ID:OTTMUSP00000026577
Original member Current member NCBI NM_001164205.1 NP_001157677.1 Accepted alive Link to Nucleotide Sequence:NM_001164205.1Link to Protein Sequence:NP_001157677.1Re-query CCDS DB by Nucleotide ID:NM_001164205Re-query CCDS DB by Protein ID:NP_001157677Link to BLink:NP_001157677.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001157677.1 287 Q8BMZ5-2 287 100% 0 0

Chromosomal Locations for CCDS 51966.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 7Link to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 3694602 3694844 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 3694978 3695227 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 3695352 3695621 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 3700615 3700715 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (864 nt):
ATGCTGGTGGTGGAGGTCGCAAATGGCCGCTCGCTGGTGTGGGGAGCCGAGGCCGTGCAGGCGCTGCGGG
AG
CGTCTGGGAGTCGGGGGACGCACGGTGGGCGCCCTGCCCCGCGGGCCCCGCCAGAACTCGCGCCTGGG
C
CTTCCGCTTCTGCTGCTGCCTGAAGAAGCCCGGCTCCTGGCCGAGATAGGCGCGGTGACCCTAGTCAGC
GCC
CCGCGCCCGGACCCCCGCAACCATGGCTTGGCCCTAGCATCGTTCAAACGCCAGCAAGAGCAGAGTT
TC
CAGGATCAGAACACTTTGGCAGCCGAGGCCCGGGAGACCCGGCGTCAGGAGCTTCTAGAGAAGATCGT
A
GAGGGCCAGGCTGCCAAGAAGCAGAAGCTGGAACAGGATTCAGGGGCAGATGAAGGAGGCCAAGAAGCC
GGT
GGAAGTGAGGCTACCCAAGGGAGTGAGACCAGTGATGATGGCCAGCCTTCTGCGGAGCAGGAGGGAG
CA
GCCCCATCCCTAGATTCTTCATCTCCCCAACCAGGACCTTCAAATGGGGTGACTCCCTTGCCCAGATC
A
GCCCTGCTTATCCAGCTGGCCACTGCCAGGCCTCGGCCTGTAAAAGCTAAGCCTCTGGACTGGCGTGTG
CAG
TCCAAAGACTGGCCCCATGCTGGCCGTCCTGCCCACGAGCTGCGCTACAGCATCTACCGAGACCTGT
GG
GAGAGAGGTTTCTTCCTCAGCGCAGCAGGGAAGTTTGGTGGTGACTTCCTGGTCTATCCTGGCCGCCT
G
GGAACCAGTGTCAGGAAGACCCTGCTGCTCTGCTCCCCTCAGCCTGATGGGAAGGTGGTCTACACATCC
CTG
CAGTGGGCCAGCCTGCAGTGA


Translation (287 aa):
MLVVEVANGRSLVWGAEAVQALRERLGVGGRTVGALPRGPRQNSRLGLPLLLLPEEARLLAEIGAVTLVS
A
PRPDPRNHGL
ALASFKRQQEQSFQDQNTLAAEARETRRQELLEKIVEGQAAKKQKLEQDSGADEGGQEA
G
GSEATQGSETSDDGQPSAEQEGA
APSLDSSSPQPGPSNGVTPLPRSALLIQLATARPRPVKAKPLDWRV
Q
SKDWPHAGRPAHELRYSIYRDLWERGFFLSAAGKFGGDFLVYP
GRLGTSVRKTLLLCSPQPDGKVVYTS
L
QWASLQ




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser