NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS51869.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
51869.1 Public Mus musculus 6 Itpr1 21 106 86 CCDS HistoryNCBI Gene:16438Re-query CCDS DB by CCDS ID:51869.1Re-query CCDS DB by GeneID:16438See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 51869.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000032192 ENSMUSP00000032192 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000032192Link to Ensembl Protein Viewer:ENSMUSP00000032192Re-query CCDS DB by Nucleotide ID:ENSMUST00000032192Re-query CCDS DB by Protein ID:ENSMUSP00000032192
Original member Current member EBI,WTSI OTTMUST00000139424 OTTMUSP00000073157 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000139424Link to Vega Protein Viewer:OTTMUSP00000073157Re-query CCDS DB by Nucleotide ID:OTTMUST00000139424Re-query CCDS DB by Protein ID:OTTMUSP00000073157
Original member Current member NCBI NM_010585.5 NP_034715.3 Accepted alive Link to Nucleotide Sequence:NM_010585.5Link to Protein Sequence:NP_034715.3Re-query CCDS DB by Nucleotide ID:NM_010585Re-query CCDS DB by Protein ID:NP_034715Link to BLink:NP_034715.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_034715.3 2749 P11881-1 2749 100% 0 0

Chromosomal Locations for CCDS 51869.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 6 (NC_000072.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 6Link to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 108236994 108237085 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108241264 108241334 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108339507 108339622 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108349598 108349684 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108351993 108352151 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108354607 108354705 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108356200 108356283 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108356391 108356537 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108363610 108363705 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108365299 108365343 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108369011 108369165 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108376762 108376861 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108377685 108377845 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108378162 108378303 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108380916 108381074 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108381188 108381360 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108382105 108382224 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108383621 108383815 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108386620 108386871 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108387364 108387505 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108388185 108388338 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108389367 108389554 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108391831 108391969 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108392531 108392585 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108393905 108394070 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108394235 108394405 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108394835 108394900 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108395976 108396113 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108399250 108399375 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108401313 108401513 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108403272 108403523 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108405400 108405525 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108406090 108406218 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108410809 108410929 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108413769 108413953 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108416810 108416958 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108417889 108418000 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108423333 108423365 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108431461 108431496 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108432646 108432696 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108438300 108438432 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108440497 108440687 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108471023 108471203 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108473407 108473660 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108481223 108481423 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108482897 108483007 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108485243 108485338 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108488486 108488608 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108489815 108489919 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108493701 108493893 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108499108 108499230 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108505877 108506052 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108510695 108510859 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108515758 108515953 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108517526 108517618 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108518690 108518829 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108519285 108519450 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108523288 108523448 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108541903 108542064 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 108549753 108549839 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (8250 nt):
ATGTCTGACAAAATGTCGAGTTTCCTACATATTGGAGACATTTGTTCTCTGTATGCGGAGGGATCTACGA
AT
GGATTTATCAGCACCTTAGGCTTGGTTGATGACCGTTGTGTTGTACAGCCAGAAGCCGGGGACCTTAA
C
AATCCACCCAAGAAATTCAGAGACTGCCTCTTTAAGCTATGTCCTATGAATCGATACTCCGCACAGAAA
CAG
TTCTGGAAAGCTGCTAAGCCCGGGGCCAACAGCACTACAGATGCAGTGCTGCTCAACAAATTGCATC
AT
GCTGCAGACTTGGAAAAGAAGCAGAATGAGACAGAAAACAGGAAATTGTTGGGGACCGTCATCCAATA
T
GGCAACGTGATCCAGCTCCTGCATTTGAAAAGCAATAAATACCTGACTGTGAATAAGAGGCTCCCAGCC
TTG
CTAGAGAAGAACGCCATGAGGGTGACGTTGGACGAGGCTGGAAATGAAGGGTCCTGGTTTTACATTC
AA
CCATTCTACAAGCTTCGCTCCATCGGAGACAGTGTGGTCATAGGCGACAAGGTAGTTTTGAATCCTGT
C
AATGCTGGCCAGCCTCTACATGCCAGCAGTCATCAGCTGGTGGATAACCCAGGCTGCAATGAGGTCAAC
TCC
GTCAACTGTAATACAAGCTGGAAGATAGTGCTTTTCATGAAATGGAGTGATAACAAAGACGATATTC
TC
AAAGGAGGTGATGTGGTGAGGCTCTTCCATGCCGAGCAAGAGAAGTTTCTCACCTGCGATGAGCACCG
G
AAGAAGCAGCATGTGTTCCTGAGGACCACCGGCAGGCAGTCAGCCACATCGGCCACCAGTTCCAAAGCC
CTG
TGGGAAGTGGAGGTAGTCCAGCACGACCCATGTCGGGGTGGAGCTGGGTACTGGAATAGCCTCTTCC
GG
TTCAAGCACCTGGCTACAGGGCATTACTTGGCTGCAGAGGTAGACCCTGACTTTGAGGAAGAATGCCT
G
GAGTTTCAGCCCTCAGTGGACCCTGATCAGGATGCATCTCGGAGTAGGTTGAGAAACGCGCAAGAAAAA
ATG
GTATACTCTCTGGTCTCCGTGCCTGAAGGCAACGACATCTCCTCCATCTTTGAGCTAGACCCCACGA
CT
CTGCGTGGAGGTGACAGCCTTGTCCCAAGGAACTCCTATGTCCGTCTCAGACACCTGTGCACCAACAC
C
TGGGTACACAGCACAAACATCCCCATCGACAAGGAAGAGGAGAAGCCTGTGATGCTGAAAATTGGTACC
TCT
CCCCTGAAGGAGGACAAGGAAGCATTTGCCATAGTTCCTGTTTCCCCTGCTGAGGTTCGGGACCTGG
AC
TTTGCCAATGATGCCAGCAAGGTGCTGGGCTCCATCGCTGGGAAGTTGGAAAAGGGCACAATCACCCA
G
AATGAGAGAAGGTCTGTCACGAAGCTTTTGGAAGACTTGGTTTACTTTGTCACGGGTGGAACTAACTCT
GGC
CAAGACGTGCTTGAAGTTGTCTTCTCTAAGCCCAATCGAGAGCGGCAGAAGCTGATGAGGGAACAGA
AT
ATTCTCAAGCAGATCTTCAAGCTGTTGCAGGCCCCCTTCACGGACTGCGGGGATGGCCCGATGCTTCG
G
CTGGAGGAGCTGGGGGATCAGCGCCATGCTCCTTTCAGACATATTTGCCGACTCTGCTACAGGGTCCTG
CGA
CACTCACAGCAAGACTACAGGAAGAACCAGGAGTACATAGCCAAGCAGTTTGGCTTCATGCAGAAGC
AG
ATTGGCTATGACGTGCTGGCCGAAGACACCATCACTGCCCTGCTCCACAACAACCGGAAACTCCTGGA
G
AAGCACATCACCGCGGCAGAGATTGACACGTTTGTCAGCCTGGTGCGAAAGAACAGGGAGCCCAGGTTC
TTG
GATTACCTCTCTGACCTCTGCGTATCCATGAACAAGTCAATCCCTGTGACACAGGAGCTCATCTGTA
AA
GCTGTGCTCAATCCCACCAATGCTGACATCCTGATTGAGACCAAGCTGGTTCTTTCTCGTTTTGAGTT
T
GAAGGCGTTTCCACTGGAGAGAATGCTCTGGAAGCCGGGGAGGATGAGGAAGAGGTGTGGCTGTTCTGG
AGG
GACAGCAACAAAGAGATCCGTAGTAAGAGTGTCCGGGAATTGGCGCAAGATGCTAAAGAGGGACAGA
AG
GAAGACAGGGACATCCTCAGCTACTACAGATATCAGCTGAACCTCTTTGCAAGGATGTGTCTGGACCG
C
CAGTACCTGGCCATCAATGAAATCTCCGGGCAGCTGGATGTTGATCTCATTCTCCGCTGCATGTCTGAC
GAG
AACCTCCCCTACGACCTCAGGGCATCCTTTTGCCGCCTCATGCTTCACATGCATGTGGACCGAGATC
CC
CAAGAGCAGGTGACACCTGTGAAATATGCCCGACTGTGGTCAGAAATTCCCTCTGAGATCGCCATTGA
T
GACTATGACAGCAGTGGAACATCCAAAGATGAAATTAAGGAGAGGTTTGCACAGACGATGGAGTTTGTG
GAG
GAGTACCTAAGAGATGTGGTTTGTCAAAGATTCCCCTTCTCTGATAAGGAGAAAAATAAGCTCACGT
TT
GAGGTTGTGAACTTAGCCAGGAATCTCATATACTTTGGTTTCTACAACTTTTCTGACCTTCTCCGATT
A
ACCAAGATCCTCTTGGCAATCTTAGACTGTGTCCATGTGACCACTATCTTCCCCATTAGCAAGATGACA
AAA
GGAGAAGAGAATAAAGGCAGTAACGTGATGAGGTCTATCCATGGCGTTGGGGAGCTGATGACCCAGG
TG
GTGCTGCGGGGAGGAGGCTTCTTGCCCATGACTCCCATGGCTGCGGCCCCTGAAGGAAATGTGAAGCA
G
GCAGAGCCAGAGAAAGAGGACATCATGGTCATGGACACCAAGTTGAAGATCATTGAAATACTCCAGTTT
ATT
TTGAATGTGAGATTGGATTATAGGATCTCCTGCCTCCTGTGTATATTTAAGCGAGAGTTTGATGAAA
GC
AATTCCCAGTCATCAGAAACATCCTCCGGAAACAGCAGCCAGGAAGGGCCAAGTAATGTGCCAGGTGC
T
CTTGACTTTGAACACATTGAAGAACAAGCGGAAGGCATCTTTGGAGGAAGTGAGGAGAACACACCTTTG
GAC
CTGGATGACCATGGTGGCAGAACCTTCCTCAGGGTCCTGCTCCACTTGACAATGCATGACTACCCAC
CC
CTGGTGTCTGGGGCCCTGCAGCTCCTCTTTCGGCACTTCAGCCAGAGGCAGGAGGTCCTTCAGGCCTT
C
AAACAGGTTCAACTGCTGGTTACTAGCCAAGATGTGGACAACTACAAACAGATCAAGCAAGACTTGGAC
CAA
CTAAGGTCCATTGTGGAGAAGTCTGAGCTCTGGGTGTACAAAGGCCAAGGTCCCGATGAGCCTATGG
AC
GGAGCCTCCGGTGAAAATGAGCATAAGAAAACCGAGGAGGGGACGAGCAAGCCACTGAAGCACGAGAG
C
ACCAGCAGCTACAACTACCGAGTGGTGAAAGAGATTTTGATTCGACTTAGCAAGCTCTGCGTGCAGGAG
AGC
GCGTCGGTGAGGAAGAGCCGGAAGCAGCAGCAACGACTGCTGAGGAACATGGGCGCACACGCTGTGG
TG
CTGGAGCTGCTGCAGATCCCCTACGAGAAGGCCGAAGACACAAAGATGCAAGAGATCATGCGGCTGGC
T
CATGAATTTTTGCAGAATTTCTGTGCAGGCAACCAGCAGAATCAAGCTTTGCTGCATAAACACATAAAC
CTG
TTTCTCAACCCAGGGATCCTGGAGGCAGTGACGATGCAGCACATCTTCATGAACAACTTCCAGCTGT
GC
AGTGAGATCAACGAGAGAGTGGTCCAGCACTTTGTTCACTGCATAGAGACCCACGGTCGAAACGTCCA
G
TATATCAAGTTTCTCCAGACGATTGTCAAGGCAGAAGGGAAATTCATTAAAAAGTGCCAAGACATGGTC
ATG
GCTGAGCTTGTCAACTCTGGAGAGGACGTCCTCGTGTTCTACAATGACAGAGCCTCTTTCCAGACTC
TG
ATCCAGATGATGCGGTCCGAGCGTGACCGGATGGATGAGAACAGCCCTCTCATGTACCACATCCATCT
G
GTGGAGCTCTTGGCCGTGTGCACAGAGGGCAAGAATGTGTACACGGAGATCAAGTGCAACTCCTTGCTC
CCG
CTCGATGACATCGTTCGTGTGGTCACTCATGAAGACTGCATCCCCGAGGTTAAGATCGCTTACATTA
AC
TTCCTGAATCACTGCTATGTGGATACGGAGGTGGAGATGAAGGAGATTTACACAAGCAACCACATGTG
G
AAGTTGTTTGAGAATTTCCTCGTGGACATCTGCAGGGCCTGTAACAACACAAGCGACAGGAAGCACGCA
GAC
TCCATTCTGGAGAAGTACGTCACTGAAATCGTGATGAGCATCGTCACCACCTTCTTCAGCTCTCCCT
TC
TCAGACCAGAGCACCACTCTGCAGACCCGCCAGCCTGTCTTTGTGCAACTCCTGCAAGGCGTGTTCCG
A
GTTTACCACTGCAACTGGCTGATGCCGAGCCAAAAAGCCTCGGTGGAGAGCTGCATCCGGGTGCTCTCT
GAC
GTAGCCAAGAGCCGGGCCATAGCCATTCCTGTTGACCTGGACAGCCAAGTCAACAACCTCTTCCTGA
AG
TCCCACAACATTGTGCAGAAAACAGCCCTGAACTGGCGGTTATCAGCCCGAAACGCCGCTCGCAGAGA
C
TCTGTACTGGCAGCATCCAGAGACTACCGAAATATCATTGAGAGGTTACAGGACATCGTGTCTGCCCTA
GAG
GACCGGCTCAGGCCCCTGGTGCAGGCTGAGCTGTCTGTGCTCGTGGATGTTCTACACAGACCAGAAC
TG
CTCTTCCCCGAGAACACGGATGCCAGGAGGAAATGTGAGAGTGGAGGTTTCATCTGCAAGCTAATAAA
A
CATACCAAGCAACTGCTGGAGGAGAATGAAGAGAAACTATGCATTAAAGTCTTACAGACCCTCAGGGAA
ATG
ATGACCAAAGACAGAGGCTATGGAGAGAAGCAAATTTCCATTGATGAATCGGAAAATGCCGAGCTGC
CA
CAGGCACCGGAAGCTGAGAACTCCACAGAGCAGGAGCTTGAACCAAGTCCACCCCTGAGGCAACTGGA
A
GACCATAAAAGGGGTGAGGCACTCCGACAAATTTTGGTCAACCGTTACTATGGAAACATCAGACCTTCA
GGA
AGAAGAGAGAGCCTTACCAGCTTTGGCAATGGCCCACTATCACCAGGAGGACCCAGCAAGCCTGGTG
GA
GGAGGGGGAGGTCCTGGATCTAGTTCCACAAGCAGGGGTGAGATGAGCCTGGCTGAGGTTCAGTGTCA
C
CTCGACAAGGAGGGGGCCTCCAACCTGGTCATCGATCTCATAATGAATGCATCCAGTGACCGAGTATTC
CAT
GAAAGCATTCTGCTGGCCATCGCACTTCTGGAAGGAGGCAACACCACCATCCAGCACTCGTTTTTCT
GC
CGGCTGACAGAAGATAAGAAATCAGAGAAGTTCTTCAAGGTTTTTTACGATCGAATGAAGGTGGCCCA
G
CAGGAAATCAAGGCGACAGTGACAGTGAACACCAGCGACTTGGGAAACAAAAAGAAAGATGATGAAGTG
GAC
AGGGATGCCCCGTCTCGGAAGAAAGCCAAAGAGCCCACAACACAGATAACAGAAGAGGTCCGGGATC
AG
CTCCTGGAAGCATCTGCTGCCACCAGGAAAGCCTTTACCACCTTCCGGAGGGAGGCCGACCCTGATGA
C
CATTACCAGTCTGGGGAGGGCACCCAGGCTACAACCGACAAAGCCAAGGATGACCTAGAGATGAGCGCT
GTC
ATCACCATCATGCAGCCTATCCTGCGCTTCCTGCAGCTGCTGTGTGAAAACCACAACCGAGATCTGC
AG
AATTTCCTTCGTTGCCAAAATAATAAGACCAACTACAATTTGGTGTGTGAGACACTGCAGTTTCTGGA
C
TGTATTTGTGGGAGCACAACCGGAGGCCTTGGTCTTCTTGGACTGTACATAAATGAAAAGAATGTAGCA
CTT
ATCAACCAAACCCTGGAGAGTCTGACGGAGTACTGTCAAGGGCCTTGCCATGAGAACCAGAACTGCA
TC
GCCACCCACGAGTCCAATGGCATCGATATCATCACAGCCCTCATCCTCAATGATATCAACCCTCTGGG
A
AAGAAGCGGATGGACCTGGTGTTAGAACTGAAGAACAATGCTTCGAAGCTGCTACTGGCCATCATGGAA
AGC
AGACACGATAGTGAAAATGCAGAGAGGATCCTGTACAACATGAGGCCCAAGGAGCTGGTGGAAGTGA
TC
AAGAAGGCCTACATGCAAGGTGAAGTGGAATTTGAGGATGGGGAGAACGGTGAGGATGGAGCTGCCTC
A
CCCAGGAACGTGGGCCACAACATCTACATCCTCGCTCACCAGTTGGCTCGGCATAACAAAGAACTTCAA
ACC
ATGCTGAAACCTGGAGGCCAGGTGGATGGGGATGAAGCTCTGGAGTTCTACGCGAAGCACACAGCAC
AA
ATTGAGATTGTCAGACTGGACCGGACAATGGAACAGATCGTCTTCCCTGTGCCCAGCATCTGTGAATT
C
CTGACTAAGGAATCGAAACTTCGAATATATTACACCACAGAGCGGGATGAGCAAGGTAGCAAGATCAAT
GAC
TTCTTCCTGCGCTCCGAGGACCTCTTTAACGAGATGAACTGGCAGAAGAAACTTCGAGCCCAGCCTG
TC
TTGTACTGGTGTGCCCGAAACATGTCTTTCTGGAGCAGCATCTCCTTCAACCTGGCCGTCCTGATGAA
C
CTGCTGGTGGCGTTTTTCTATCCATTTAAAGGAGTAAGGGGAGGAACACTAGAGCCACACTGGTCAGGC
CTT
CTGTGGACAGCCATGCTCATCTCTCTGGCCATTGTCATTGCTCTGCCCAAGCCCCACGGCATCCGGG
CC
TTAATTGCTTCTACAATCCTACGACTGATATTTTCAGTTGGGTTGCAGCCCACACTGTTTCTGCTGGG
A
GCTTTCAATGTCTGCAATAAAATCATCTTCCTGATGAGCTTTGTGGGCAACTGTGGGACCTTCACCAGA
GGC
TACCGGGCCATGGTTCTGGATGTGGAGTTCCTCTATCATTTGCTGTATCTACTCATCTGTGCCATGG
GC
CTCTTCGTACATGAGTTCTTCTATAGCTTGCTGCTTTTTGATTTAGTGTACAGAGAGGAGACTTTGCT
T
AATGTCATTAAAAGTGTCACCCGCAATGGACGGTCCATCATCTTGACAGCGGTCCTGGCTCTGATCCTG
GTT
TACCTGTTCTCAATTGTGGGCTATCTGTTCTTCAAGGATGACTTTATCTTGGAAGTAGATAGGTTGC
CC
AATGAAACAGCTGTTCCAGAAACTGGCGAGAGTTTGGCCAACGATTTCCTGTACTCTGATGTGTGCAG
G
GTAGAGACGGGGGAGAACTGCACCTCTCCTGCACCCAAAGAAGAGCTGCTCCCTGCCGAAGAAACGGAA
CAG
GATAAGGAACACACGTGTGAGACCCTGCTCATGTGCATCGTCACTGTTCTGAGTCACGGGCTGCGGA
GT
GGGGGAGGGGTAGGAGACGTGCTCAGGAAGCCATCCAAAGAGGAGCCTCTGTTTGCTGCAAGGGTGAT
C
TACGACCTCCTCTTCTTCTTCATGGTCATCATCATCGTCCTGAACCTGATTTTCGGGGTCATCATTGAC
ACC
TTTGCTGACCTGAGGAGTGAGAAGCAAAAGAAGGAGGAGATCTTAAAAACCACGTGCTTCATCTGCG
GC
TTGGAAAGGGACAAGTTTGACAATAAGACTGTCACCTTTGAAGAGCACATCAAGGAAGAGCACAACAT
G
TGGCACTATCTGTGCTTCATCGTGCTGGTGAAAGTGAAGGACTCCACAGAGTACACCGGGCCTGAGAGT
TAC
GTGGCAGAGATGATCAGGGAAAGAAACCTTGATTGGTTCCCCAGAATGAGAGCCATGTCCCTGGTCA
GC
AGCGATTCTGAAGGGGAACAGAACGAGCTGAGGAACCTGCAGGAGAAGCTGGAGTCTACCATGAAGCT
G
GTCACCAATCTTTCTGGCCAGCTGTCAGAACTAAAGGACCAGATGACAGAACAGAGGAAGCAGAAACAA
AGA
ATCGGCCTTCTAGGACATCCTCCTCACATGAATGTCAACCCACAGCAGCCGGCCTAG


Translation (2749 aa):
MSDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPEAGDLNNPPKKFRDCLFKLCPMNRYSAQK
Q
FWKAAKPGANSTTDAVLLNKLH
HAADLEKKQNETENRKLLGTVIQYGNVIQLLHLKSNKYLTVNKRLPA
L
LEKNAMRVTLDEAGNEGSWFYIQPFYKLRSIGDS
VVIGDKVVLNPVNAGQPLHASSHQLVDNPGCNEVN
S
VNCNTSWKIVLFMKWSDNKDDILKG
GDVVRLFHAEQEKFLTCDEHRKKQHVFLRTTGRQSATSATSSKA
L
WEVE
VVQHDPCRGGAGYWNSLFRFKHLATGHYLAAEVDPDFEEECLEFQPSVDPDQDASRSRLRNAQEK
M
VYSLVSVPEGNDISSIFELDPTTLRGGDSLVP
RNSYVRLRHLCTNTWVHSTNIPIDKEEEKPVMLKIGT
S
PLKEDKEAFAIVPVSPAEVRDLDFANDASKVLGSIAGKLEKGTITQNER
RSVTKLLEDLVYFVTGGTNS
G
QDVLEVVFSKPNRERQKLMREQNILKQ
IFKLLQAPFTDCGDGPMLRLEELGDQRHAPFRHICRLCYRVL
R
HSQQDYRKNQ
EYIAKQFGFMQKQIGYDVLAEDTITALLHNNRKLLEKHITAAEIDTFVSLVRKNREPRF
L
DYLSDLCVSMNKSIPVTQELICKAVLNPTNADILIET
KLVLSRFEFEGVSTGENALEAGEDEEEVWLFW
R
DSNKEIRSKSVRELAQDAKEGQKEDRDILSYY
RYQLNLFARMCLDRQYLAINEISGQLDVDLILRCMSD
E
NLPYDLRASFCRLMLHMHVDRDPQEQVTPVKYARLWSEIPSEIAID
DYDSSGTSKDEIKERFAQTMEFV
E
EYLRDVVCQRFPFSDKEKNKLTFE
VVNLARNLIYFGFYNFSDLLRLTKILLAILDCVHVTTIFPISKMT
K
GEENK
GSNVMRSIHGVGELMTQVVLRGGGFLPMTPMAAAPEGNVKQAEPEKEDIMVMDTKLKIIEILQF
I
LNVRLDYRISCLLCIFKREFDESNSQSSETSSGNSSQEGPSNVP
GALDFEHIEEQAEGIFGGSEENTPL
D
LDDHGGRTFLRVLLHLTMHDYPPLVSGALQLLFRHFSQRQEVLQAFKQ
VQLLVTSQDVDNYKQIKQDLD
Q
LRSIVEKSELWVYKGQGPDEPMDGASGENEHKKTE
EGTSKPLKHESTSSYNYRVVKEILIRLSKLCVQE
S
ASVRKSRKQQQRLLRNMGAHAVVLELLQIPYEK
AEDTKMQEIMRLAHEFLQNFCAGNQQNQALLHKHIN
L
FLNPG
ILEAVTMQHIFMNNFQLCSEINERVVQHFVHCIETHGRNVQYIKFLQTIVKAEGKFIKKCQDMV
M
AE
LVNSGEDVLVFYNDRASFQTLIQMMRSERDRMDENSPLMYHIHLVELLAVCTEGKNVYTEIKCNSLL
P
LDDIVRVVTHEDCIPE
VKIAYINFLNHCYVDTEVEMKEIYTSNHMWKLFENFLVDICRACNNTSDRKHA
D
SILEKYVTEIVMSIVTTFFSSPFSDQSTTLQ
TRQPVFVQLLQGVFRVYHCNWLMPSQKASVESCIRVLS
D
V
AKSRAIAIPVDLDSQVNNLFLKSHNIVQKTALNWRLSARNAARRDSVLAASRDYRNIIERLQDIVSAL
E
DRLRPLVQAELSVLVDVLHRPELLFPENTDARRKCESGGFIC
KLIKHTKQLLEENEEKLCIKVLQTLRE
M
MTKDRGYGEK
QISIDESENAELPQAPEAENSTEQELEPSPPLRQLEDHKRGEALRQILVNRYYGNIRPS
G
RRESLTSFGNGPLSPGGPSKPGGG
GGGPGSSSTSRGEMSLAEVQCHLDKEGASNLVIDLIMNASSDRVF
H
ESILLAIALLEGGNTTIQ
HSFFCRLTEDKKSEKFFKVFYDRMKVAQQEIKATVTVNTSDLGNKKKDDEV
D
RDAPSRKK
AKEPTTQITEEVRDQLLEASAATRKAFTTFRREADPDDHYQSGEGTQATTDKAKDDLEMSA
V
ITIMQPILRFLQLLCENHNRDLQ
NFLRCQNNKTNYNLVCETLQFLDCICGSTTGGLGLLGLYINEKNVA
L
INQTLESLTEYCQGPCHENQ
NCIATHESNGIDIITALILNDINPLGKKRMDLVLELKNNASKLLLAIME
S
RHDSENAERILYNMRPKEL
VEVIKKAYMQGEVEFEDGENGEDGAASPRNVGHNIYILAHQLARHNKELQ
T
MLKPGGQVDGDEALEFYAKHTAQIE
IVRLDRTMEQIVFPVPSICEFLTKESKLRIYYTTERDEQGSKIN
D
FFLRSEDLFNEMNWQKKLR
AQPVLYWCARNMSFWSSISFNLAVLMNLLVAFFYPFKGVRGGTLEPHWSG
L
LWTAMLISLAIVIALPKPHGIRALIASTILRLIFSVGLQPTLFLLGAFN
VCNKIIFLMSFVGNCGTFTR
G
YRAMVLDVEFLYHLLYLLICAMGLFVHEFFYSLL
LFDLVYREETLLNVIKSVTRNGRSIILTAVLALIL
V
YLFSIVGYLFFKDDFILEVDRLPNETAVP
ETGESLANDFLYSDVCRVETGENCTSPAPKEELLPAEETE
Q
DKEHTCETLLMCIVTVLSHGLRSGGGVGDVLRKPSKE
EPLFAARVIYDLLFFFMVIIIVLNLIFGVIID
T
FADLRSEKQKKEEILKTTCFIC
GLERDKFDNKTVTFEEHIKEEHNMWHYLCFIVLVKVKDSTEYTGPES
Y
VAEMIR
ERNLDWFPRMRAMSLVSSDSEGEQNELRNLQEKLESTMKLVTNLSGQLSELKDQMTEQRKQKQ
R
IGLLGHPPHMNVNPQQPA




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser