NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS51510.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
51510.1 Public Mus musculus 5 Apbb2 21 106 86 CCDS HistoryNCBI Gene:11787Re-query CCDS DB by CCDS ID:51510.1Re-query CCDS DB by GeneID:11787See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 51510.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000162349 ENSMUSP00000123752 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000162349Link to Ensembl Protein Viewer:ENSMUSP00000123752Re-query CCDS DB by Nucleotide ID:ENSMUST00000162349Re-query CCDS DB by Protein ID:ENSMUSP00000123752
Original member Current member EBI,WTSI OTTMUST00000137968 OTTMUSP00000072603 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000137968Link to Vega Protein Viewer:OTTMUSP00000072603Re-query CCDS DB by Nucleotide ID:OTTMUST00000137968Re-query CCDS DB by Protein ID:OTTMUSP00000072603
Original member Current member NCBI NM_009686.2 NP_033816.1 Accepted alive Link to Nucleotide Sequence:NM_009686.2Link to Protein Sequence:NP_033816.1Re-query CCDS DB by Nucleotide ID:NM_009686Re-query CCDS DB by Protein ID:NP_033816Link to BLAST:NP_033816.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_033816.1 760 Q9DBR4-1 760 100% 0 0

Chromosomal Locations for CCDS 51510.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 66302542 66302709 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 66307535 66307714 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 66309078 66309193 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 66311000 66311083 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 66312159 66312246 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 66313315 66313429 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 66323602 66323607 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 66362718 66362845 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 66364974 66365120 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 66391627 66391687 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 66391772 66391857 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 66392273 66392335 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 66400076 66400281 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 66451468 66452283 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 66462098 66462116 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2283 nt):
ATGTCAGAAGTACTTCCAGCTGACTCAGGTGTTGGCACCTTGGCAGTGTTTATGGCCAGCAGCGGATCCA
CA
GACATTGCAAACCGGAACAGCCCAGCCACACCACCAAATACCCTCAATCTCCGTTCCTCCCACAATGA
A
CTATTAAATGCAGAGATCAAACACTCAGATGCCAAGAACAGCACGCCCCCCAAATGCAGGAAAAAATAT
GCA
CTGACTAATATTCAGGCGGCCATGGGCCTCTCGGATCCAGCTGTACAGCCCCTGCTGGGAAACGGCT
CT
GCCAACATCAAGCTGGTTAAAAATGGGGAGAACCAGCTCCGCAAGGCTGCAGAACAGGGGCAGCAGGA
C
CCCAACAAGAACCTCAGCCCTGCAGCCGTCATCAACCTAACCTCCGAGAAGCTGGAGGTTAAAGATCCC
CAC
CCACAGGAGTCTTCAGGCTGTGAGATTTTGCCCTCCCAGCCCAGGAGAACTAAGAGCTTCCTCAATT
AC
TATGCAGACCTGGAAACCTCGGCTAGAGAGCTAGGGCAGAACCTGGGCCCCTGCCAAGGGGTTGGAGA
G
GAGAAAGCCCAGCCTGGCCCAGGCCAGGCCCCAGTAGTCATTGGGAATGGTGACTTGCTGCCACAGAAA
CCA
AACAAACCCCAATCCAGCCCAGAGGATGGCCAAGTAGCCACAGTATCGTCCAGCCCAGAGACCAAGA
AA
GACCACCCTAAAACAGGAGCCAAAACCGACTGTGCCCTCCATCGGATCCAGAACCTGGCACCAAGTGA
C
GAGGAATCCAGCTGGACGACGCTGTCCCAAGACAGTGCCTCCCCCAGCTCCCCAGATGAAACAGATATC
TGG
AGTGATCACTCATTTCAGACAGATCCCGATTTGCCGCCGGGCTGGAAGAGAGTCAATGACATTGCCG
GG
ACCTATTACTGGCACATCCCAACAGGGACGACTCAATGGGAACGGCCTGTCTCCATCCCAGCAGATCT
C
CACGGCTCTAGGAAAGGGTCACTTAGTTCTGTAACGCCATCGCCCACCCCAGAGAATGAGAAACAGCCA
TGG
AGTGATTTTGCTGTTCTGAATGGGGGAAAGATTAATAGTGACATTTGGAAGGATTTGCACGCAGCCA
CA
GTTAACCCAGACCCCAGTTTAAAAGAGTTTGAAGGAGCAACGCTACGCTATGCATCCTTGAAACTCAG
A
AACGCCCCTCATGGTGATGACGATGATTCTTGTAGTATCAACAGTGACCCAGAAGCCAAGTGTTTTGCT
GTG
CGTTCTCTGGGCTGGGTAGAGATGGCCGAGGAGGACCTTGCCCCCGGGAAGAGCAGTGTCGCTGTCA
AC
AACTGCATCCGACAGCTTTCCTACTGCAAAAACGACATCCGGGACACAGTCGGCATCTGGGGAGAGGG
C
AAAGACATGTACCTGAGCCTGGAAAACGACATGCTCAGCCTGGTGGACCCCATGGACCGCTCCGTGTTA
CAC
TCCCAGCCCATCGTGAACATCCGAGTGTGGGGCGTGGGCCGAGACAACGGCCGAGAGAGGGACTTTG
CT
TACGTGGCGAGAGACAAGGACACAAGGATTCTGAAATGCCATGTGTTTCGATGTGACACACCAGCAAA
A
GCCATTGCCACAAGTCTCCACGAAATCTGCTCCAAGATTATGGCTGAACGGAAGAACGCCAAAGCACTG
GCC
TGCAGCTCCTTACAGGAGAGGACCAATATGAGTCTCGATGTCCCTTTGCAAGTAGATTTTCCAACAC
CA
AAGACGGAGCTGGTGCAGAAGTTCCGCGTGCAGTACCTGGGCATGTTACCTGTAGACAGACCTGTCGG
C
ATGGACACCCTGAACAGTGCCATAGAAAATCTCATGACGTCATCCAGCAAGGAGGACTGGCCTTCGGTG
AAC
ATGAACGTGGCCGACGCCACTGTGACTGTCATCAGTGAAAAGAATGAAGAGGAGGTCTTGGTGGAGT
GT
CGAGTGCGGTTCCTGTCCTTCATGGGTGTCGGGAAGGATGTCCACACATTCGCCTTCATCATGGACAC
T
GGGAACCAGCGCTTTGAGTGCCATGTGTTCTGGTGTGAGCCTAACGCAGCCAATGTGTCAGAAGCTGTC
CAG
GCTGCCTGCATGTTGCGGTATCAGAAGTGCTTGGTTGCCAGGCCACCTTCGCAGAAAGTCCGGCCCC
CG
CCCCCGCCAGCAGATTCAGTGACCCGAAGAGTCACGACCAATGTGAAACGAGGGGTCTTATCCCTCAT
T
GACACTTTGAAACAGAAGCGGCCGGTCACAGAGACTCCCTAG


Translation (760 aa):
MSEVLPADSGVGTLAVFMASSGSTDIANRNSPATPPNTLNLRSSHNELLNAEIKHSDAKNSTPPKCRKKY
A
LTNIQAAMGLSDPAVQPLLGNGSANIKLVKNGENQLRKAAEQGQQDPNKNLSPAAVINLTSEKLEVKDP
H
PQESSGCEILPSQPRRTKSFLNYYADLETSARELGQNLGPCQGVGEEKAQPGPGQAPVVIGNGDLLPQK
P
NKPQSSPEDGQVATVSSSPETKKDHPKTGAKTDCALHRIQNLAPSDEESSWTTLSQDSASPSSPDET
DI
W
SDHSFQTDPDLPPGWKRVNDIAGTYYWHIPTGTTQWERPVSIPADLHGSRKGSLSSVTPSPTPENE
KQP
W
SDFAVLNGGKINSDIWK
DLHAATVNPDPSLKEFEGATLRYASLKLRNAPHGDDDDSCSINSDPEAKCFA
V
RSLGWVEMAEEDLAPGKSSVAVNNCIRQLSYCKNDIRDTVGIWGE
GKDMYLSLENDMLSLVDPMDRSVL
H
SQPIVNIRVWGVGRDNG
RERDFAYVARDKDTRILKCHVFRCDTPAKAIATSLHEICSKIMAERKNAKAL
A
CSSLQERTNMSLDVPLQ
VDFPTPKTELVQKFRVQYLGMLPVDRPVGMDTLNSAIENLMTSSSKEDWPSV
N
MNVADATVTVISEK
NEEEVLVECRVRFLSFMGVGKDVHTFAFIMDTGNQRFECHVFWCEPNAANVSEAV
Q
AACM
LRYQKCLVARPPSQKVRPPPPPADSVTRRVTTNVKRGVLSLIDTLKQKRPVTETP



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser