NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS51482.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
51482.1 Public Mus musculus 5 Slc2a9 21 106 86 CCDS HistoryNCBI Gene:117591Re-query CCDS DB by CCDS ID:51482.1Re-query CCDS DB by GeneID:117591See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 51482.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000143758 ENSMUSP00000118430 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000143758Link to Ensembl Protein Viewer:ENSMUSP00000118430Re-query CCDS DB by Nucleotide ID:ENSMUST00000143758Re-query CCDS DB by Protein ID:ENSMUSP00000118430
Original member Current member EBI,WTSI OTTMUST00000064927 OTTMUSP00000032289 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000064927Link to Vega Protein Viewer:OTTMUSP00000032289Re-query CCDS DB by Nucleotide ID:OTTMUST00000064927Re-query CCDS DB by Protein ID:OTTMUSP00000032289
Original member Current member NCBI NM_001102415.1 NP_001095885.1 Accepted alive Link to Nucleotide Sequence:NM_001102415.1Link to Protein Sequence:NP_001095885.1Re-query CCDS DB by Nucleotide ID:NM_001102415Re-query CCDS DB by Protein ID:NP_001095885Link to BLAST:NP_001095885.1

Chromosomal Locations for CCDS 51482.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 38351083 38351337 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 38362843 38362970 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 38379918 38379993 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 38382043 38382144 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 38391714 38391824 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 38436540 38436685 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 38440650 38440774 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 38453102 38453262 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 38477395 38477493 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 38480039 38480131 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1296 nt):
ATGGATTCCAGGGAGCTTGCTTTAGCTTCCCTGATGTGTGACACCGGTGGCCCTGGGGAGCTCTCTGTGG
GT
CACCAGCAGAGGAGGACAAAGAAATGGTCCTTCTCGCTCGTCGTGGCAGCTCTCGTGGGAGCCTTCGG
G
TCCTCCTTCCTCTACGGGTACAACCTCTCCGTGGTGAACGCGCCCACGCCGTATATCAAGGCCTTTTAC
AAT
GGAACCTGGTACAGGAGGCATGGACAGCCCATTGACCCGGATACCCTGACTCTGCTCTGGTCTGTGA
CT
GTGTCCATATTTGCGATTGGTGGCCTGGTGGGAACGCTGATGGTGAAGATGATTGGAAAGTTTCTTGG
G
AGGAAGTCCACATTGCTGGTCAACAATGGATTTGCCATTTCCGCAGCGTTGCTGATGGCATGCTCACTC
CGG
GCAGGAACCTTTGAGATGCTCATTGTGGGACGGTTCATCATGGGTGTGGATGGAGGCATTGCACTCA
GC
GCGCTCCCCATGTATCTCAACGAGATCTCACCCAAGGAGATCCGGGGCTCTCTGGGCCAGGTGACTGC
C
ATCTTCATCTGCATTGGCGTGTTTTCTGGACAGTTGCTGGGCCTGCCGGAGCTGCTGGGAAGGATCTGG
TTC
TACACCAACAGCATCTTTGGGAAAGCTGGGATCCCTCAGGACAAGATCCCATACATCACCCTGAGCA
CG
GGAGGAATTGAAACACTGGCTGCTATCTTCTCTGGCTTGGTCATTGAGCGCTTAGGAAGGAGACCTCT
C
CTCATTGGTGGCTTCGGGCTGATGGCCCTCTTCTTTGGGACCCTCACCGCGACACTGACCCTGCAGGAC
CAA
GCTCCCTGGGTCCCTTACCTCAGCATTGTGTGCATCTTGGCCATCATTGCCTCGTTCTGCAGCGGTC
CA
GGTGGGATCCCATTCATCCTGACCGGAGAGTTCTTCCAACAGTCAGAGCGACCGGCAGCCTTCATGAT
C
GCAGGCACAGTCAACTGGCTCTCAAACTTCGCCGTAGGGCTCCTTTTCCCTTTCATCCAGAAAAGCCTG
GAC
TCCTACTGCTTCCTCGTCTTCGCCACAATATGTATCGCAGGTGCTACCTACTTCTATTTTGTCCTCC
CG
GAGACCAAGAACAGAACCCATGCAGAAATCAGCCAGGCATTTGCCAAGAGGAACAAGGCTCAGCCCCC
A
GAGGTGAAGGCTGATTCAGCCATGACTGAGGAGAAGGCCAACAGCCAGACTGAGCCCGATTCATCCTCC
ACG
CTGGACAGCTATGGCCAAAACAAAATTGTCTAA


Translation (431 aa):
MDSRELALASLMCDTGGPGELSVGHQQRRTKKWSFSLVVAALVGAFGSSFLYGYNLSVVNAPTPYIKAFY
N
GTWYRRHGQPIDPDTLTLLWSVTVSIFAIGGLVGTLMVKMIGKFLG
RKSTLLVNNGFAISAALLMACSL
R
AGTFEMLIVGRFIMGVDG
GIALSALPMYLNEISPKEIRGSLGQVTAIFICIGVFSGQLLGLPELLGRIW
F
YTNSIFGKAGIPQDKIPYITLSTGGIETLAAIFS
GLVIERLGRRPLLIGGFGLMALFFGTLTATLTLQD
Q
APWVPYLSIVCILAIIASFCSGP
GGIPFILTGEFFQQSERPAAFMIAGTVNWLSNFAVGLLFPFIQKSL
D
SYCFLVFATICIAGATYFYFVLPETKNRTHAEISQAFAKRNKAQPPEVKADSAMTEEKANSQTEPDSSS
T
LDSYGQNKIV




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser