NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS51397.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
51397.1 Public Mus musculus 4 Trp73 21 106 86 CCDS HistoryNCBI Gene:22062Re-query CCDS DB by CCDS ID:51397.1Re-query CCDS DB by GeneID:22062See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 51397.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000133533 ENSMUSP00000114418 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000133533Link to Ensembl Protein Viewer:ENSMUSP00000114418Re-query CCDS DB by Nucleotide ID:ENSMUST00000133533Re-query CCDS DB by Protein ID:ENSMUSP00000114418
Original member Current member EBI,WTSI OTTMUST00000024474 OTTMUSP00000011256 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000024474Link to Vega Protein Viewer:OTTMUSP00000011256Re-query CCDS DB by Nucleotide ID:OTTMUST00000024474Re-query CCDS DB by Protein ID:OTTMUSP00000011256
Original member Current member NCBI NM_001126330.1 NP_001119802.1 Accepted alive Link to Nucleotide Sequence:NM_001126330.1Link to Protein Sequence:NP_001119802.1Re-query CCDS DB by Nucleotide ID:NM_001126330Re-query CCDS DB by Protein ID:NP_001119802Link to BLink:NP_001119802.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001119802.1 590 Q9JJP2-2 590 100% 0 0

Chromosomal Locations for CCDS 51397.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 4Link to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 154058991 154059326 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154060588 154060681 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154061362 154061500 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154061953 154062101 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154062512 154062639 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154063885 154063973 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154064313 154064455 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154064638 154064747 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154067010 154067125 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154067577 154067763 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154081329 154081571 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154096894 154096932 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1773 nt):
ATGCTTTACGTCGGTGACCCCATGAGACACCTCGCCACGGCCCAGTTCAATTTGCTCAGCAGTGCCATGG
AC
CAGATGGGCAGCCGTGCGGCCCCGGCGAGCCCCTACACCCCGGAGCACGCCGCCAGCGCGCCCACCCA
C
TCGCCCTACGCGCAGCCCAGCTCCACCTTCGACACCATGTCTCCGGCGCCTGTCATCCCTTCCAATACC
GAC
TACCCCGGCCCCCACCACTTCGAGGTCACCTTCCAGCAGTCGAGCACTGCCAAGTCGGCCACCTGGA
CA
TACTCCCCACTCTTGAAGAAGTTGTACTGTCAGATTGCTAAGACATGCCCCATCCAGATCAAAGTGTC
C
ACACCACCACCCCCGGGCACGGCCATCCGGGCCATGCCTGTCTACAAGAAGGCAGAGCATGTGACCGAC
ATT
GTTAAGCGCTGCCCCAACCACGAGCTTGGAAGGGACTTCAATGAAGGACAGTCTGCCCCGGCTAGCC
AC
CTCATCCGTGTAGAAGGCAACAACCTCGCCCAGTACGTGGATGACCCTGTCACCGGAAGGCAGAGTGT
G
GTTGTGCCGTATGAACCCCCACAGGTGGGAACAGAATTTACCACCATCCTGTACAACTTCATGTGTAAC
AGC
AGCTGTGTGGGGGGCATGAATCGGAGGCCCATCCTTGTCATCATCACCCTGGAGACCCGGGATGGAC
AG
GTCCTGGGCCGCCGGTCTTTCGAGGGTCGCATCTGTGCCTGTCCTGGCCGTGACCGCAAAGCTGATGA
A
GACCATTACCGGGAGCAACAGGCTCTGAATGAAAGTACCACCAAAAATGGAGCTGCCAGCAAACGTGCA
TTC
AAGCAGAGCCCCCCTGCCATCCCTGCCCTGGGTACCAACGTGAAGAAGAGACGCCACGGGGACGAGG
AC
ATGTTCTACATGCACGTGCGAGGCCGGGAGAACTTTGAGATCTTGATGAAAGTCAAGGAGAGCCTAGA
A
CTGATGGAGCTTGTGCCCCAGCCTTTGGTTGACTCCTATCGACAGCAGCAGCAGCAGCAGCTCCTACAG
AGG
CCGAGTCACCTGCAGCCTCCATCCTATGGGCCCGTGCTCTCCCCAATGAACAAGGTACACGGTGGTG
TC
AACAAACTGCCCTCCGTCAACCAGCTGGTGGGCCAGCCTCCCCCGCACAGCTCAGCAGCTGGGCCCAA
C
CTGGGGCCCATGGGCTCCGGGATGCTCAACAGCCACGGCCACAGCATGCCGGCCAATGGTGAGATGAAT
GGA
GGCCACAGCTCCCAGACCATGGTTTCGGGATCCCACTGCACCCCGCCACCCCCCTATCATGCAGACC
CC
AGCCTCGTCAGTTTTTTGACAGGGTTGGGGTGTCCAAACTGCATCGAGTGCTTCACTTCCCAAGGGTT
G
CAGAGCATCTACCACCTGCAGAACCTTACCATCGAGGACCTTGGGGCTCTGAAGGTCCCTGACCAGTAC
CGT
ATGACCATCTGGAGGGGCCTACAGGACCTGAAGCAGAGCCATGACTGCGGCCAGCAACTGCTACGCT
CC
AGCAGCAACGCGGCCACCATCTCCATCGGCGGCTCTGGCGAGCTGCAGCGGCAGCGGGTCATGGAAGC
C
GTGCATTTCCGTGTGCGCCACACCATCACGATCCCCAACCGTGGAGGCGCAGGTGCGGTGACAGGTCCC
GAC
GAGTGGGCGGACTTTGGCTTTGACCTGCCTGACTGCAAGTCCCGTAAGCAGCCCATCAAAGAGGAGT
TC
ACAGAGACAGAGAGCCACTGA


Translation (590 aa):
MLYVGDPMRHLATAQFNLLSSAMDQMGSRAAPASPYTPEHAASAPTHSPYAQPSSTFDTMSPAPVIPSNT
D
YPGPHHFEVTFQQSSTAKSATWT
YSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPVYKKAEHVTD
I
VKRCPNHELGRDFNE
GQSAPASHLIRVEGNNLAQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCN
S
SCVGGMNRRPILVIITLETR
DGQVLGRRSFEGRICACPGRDRKADEDHYREQQALNESTTKNGAASKRA
F
KQSPPAIPALGTNVKKRRHGDEDMFYMH
VRGRENFEILMKVKESLELMELVPQPLVDSYRQQQQQQLLQ
R
PSHLQPPSYGPVLSPMNKVHGGVNKLPSVNQLVGQPPPHSSAAGPNLGPMGSGMLNSHGHSMPANGEMN
G
GHSSQTMVSGSHCTPPPPYHADPSLV
SFLTGLGCPNCIECFTSQGLQSIYHLQNLTIEDLGALKVPDQY
R
MTIWRGLQDLKQSHDCGQQLLRSSSNAATISIGGSGELQRQRVMEAVHFRVRHTITIPNRGGAGAVTGP
D
EWADFGFDLPDCKSRKQPIKEEFTETESH




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser