NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS51327.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
51327.1 Public Mus musculus 4 Ldlrap1 21 106 86 CCDS HistoryNCBI Gene:100017Re-query CCDS DB by CCDS ID:51327.1Re-query CCDS DB by GeneID:100017See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 51327.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000037828 ENSMUSP00000036749 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000037828Link to Ensembl Protein Viewer:ENSMUSP00000036749Re-query CCDS DB by Nucleotide ID:ENSMUST00000037828Re-query CCDS DB by Protein ID:ENSMUSP00000036749
Original member Current member EBI,WTSI OTTMUST00000026035 OTTMUSP00000011915 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000026035Link to Vega Protein Viewer:OTTMUSP00000011915Re-query CCDS DB by Nucleotide ID:OTTMUST00000026035Re-query CCDS DB by Protein ID:OTTMUSP00000011915
Original member Current member NCBI NM_145554.2 NP_663529.2 Accepted alive Link to Nucleotide Sequence:NM_145554.2Link to Protein Sequence:NP_663529.2Re-query CCDS DB by Nucleotide ID:NM_145554Re-query CCDS DB by Protein ID:NP_663529Link to BLink:NP_663529.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_663529.2 308 Q8C142 308 100% 0 0

Chromosomal Locations for CCDS 51327.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 4Link to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 134747052 134747199 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 134748282 134748316 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 134749337 134749467 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 134749959 134750042 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 134750382 134750454 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 134755193 134755307 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 134757341 134757453 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 134758919 134759061 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 134767816 134767900 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (927 nt):
ATGGACGCGCTCAAGTCGGCGGGGCGCGCGCTAATCCGGAGCCCCAGTCTGGCCAAGCAGAGCTGGGCGG
GC
GGCCGGCACCGCAAGTTGCCAGAGAACTGGACGGACACGCGGGAGACACTGCTGGAGGGCATGGTTTT
C
AGCCTCAAGTACCTTGGTATGACGCTGGTGGAGCGGCCCAAGGGCGAGGAGCTGTCTGCAGCTGCTGTC
AAG
AGGATCGTAGCTACAGCCAAGGCCAGCGGGAAGAAGCTGCAGAAGGTGACACTCAAGGTGTCACCCC
GG
GGGATCATCCTGACCGACAGCCTCACTAGCCAGCTCATCGAGAACGTGTCCATTTACAGGATCTCCTA
C
TGCACTGCAGACAAGATGCACGACAAGGTGTTCGCCTACATCGCCCAGAGCCAGCAGAACGAGAGCCTC
GAG
TGCCACGCCTTCCTCTGCACCAAGCGGAAAGTGGCCCAAGCCGTCACCCTGACTGTAGCCCAAGCCT
TC
AAAGTTGCCTTTGAGTTTTGGCAGGTGTCCAAGGAAGAGAAAGAGAAAAGGGAGAAAGCCAACCAGGA
A
GGAGGAGACGTCCCAGGGACCCGACGGGACAGCACCCCCTCACTGAAAACCTTGGTCGCTACCGGGAAC
CTG
CTGGATTTGGAAGAGGTGGCTAAGGCCCCGTTATCTACAGTCAGCGCTAATACCAACAACGTGGACG
AG
ACACCACGGCCTCAGGTCTTGGGCAACAACAGCGTCGTCTGGGAGCTGGATGACGGCCTGGACGAAGC
A
TTTTCAAGGCTGGCGCAGTCCCGGACAAACCCTCAAGTCCTGGACACTGGACTGTCAGCACAGGACATC
CAT
TATGCACAGTGCTTATCGCCCACCGACTGGGACAAGCCTGACAGCAGTGGCATTGATCAAGATGATG
AC
GTCTTCACCTTCTGA


Translation (308 aa):
MDALKSAGRALIRSPSLAKQSWAGGRHRKLPENWTDTRETLLEGMVFSLKYLGMTLVERPKGEELSAAAV
K
RIVAT
AKASGKKLQKVTLKVSPRGIILTDSLTSQLIENVSIYRISYCTADKMHDKVFAYIAQSQQNESL
E
CHAFLCTKRKV
AQAVTLTVAQAFKVAFEFWQVSKEEKEKREKANQEGGDVPGTRRDSTPSLKTLVATGN
L
LDLEEVAKAPLSTVSANTNNVDETPRPQVLGNNSVVW
ELDDGLDEAFSRLAQSRTNPQVLDTGLSAQDI
H
YAQCLSPTDWDKPDSSGIDQDDDVFTF




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser