NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS51279.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
51279.1 Public Mus musculus 4 Eif2b3 21 106 86 CCDS HistoryNCBI Gene:108067Re-query CCDS DB by CCDS ID:51279.1Re-query CCDS DB by GeneID:108067See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 51279.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000106448 ENSMUSP00000102056 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000106448Link to Ensembl Protein Viewer:ENSMUSP00000102056Re-query CCDS DB by Nucleotide ID:ENSMUST00000106448Re-query CCDS DB by Protein ID:ENSMUSP00000102056
Original member Current member EBI,WTSI OTTMUST00000022643 OTTMUSP00000010337 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000022643Link to Vega Protein Viewer:OTTMUSP00000010337Re-query CCDS DB by Nucleotide ID:OTTMUST00000022643Re-query CCDS DB by Protein ID:OTTMUSP00000010337
Original member Current member NCBI NM_001111277.1 NP_001104747.1 Accepted alive Link to Nucleotide Sequence:NM_001111277.1Link to Protein Sequence:NP_001104747.1Re-query CCDS DB by Nucleotide ID:NM_001111277Re-query CCDS DB by Protein ID:NP_001104747Link to BLink:NP_001104747.1

Chromosomal Locations for CCDS 51279.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 4Link to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 117022165 117022312 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 117028411 117028556 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 117044436 117044595 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 117052724 117052835 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 117058764 117058853 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 117065341 117065468 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 117066374 117066564 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 117068744 117068821 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 117070639 117070787 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 117081558 117081661 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 117086689 117086741 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1359 nt):
ATGGAGTTTCAAGCGGTGGTTATGGCCGTTGGTGGGGGATCTCGGATGACAGACTTGACTTCCAGCATTC
CC
AAGCCTCTGCTTCCAGTTGGAAACAAACCTTTAATTTGGTACCCGCTGAACCTGCTTGAGCGTGTTGG
A
TTTGAAGAAGTCATCGTGGTTACAACCAAAGATGTCCAAAAGGCTCTCTGCGCAGAATTCAAGATGAAG
ATG
AAGCTAGATATTGTGTGCATTCCTGATGAGGCAGACATGGGGACTGCAGATTCTCTACGACACATCT
AT
CCAAAGCTTAAGACCGATGTGCTGGTCCTGAGCTGCGATCTGATAACAGATGTGGCTTTACATGAGGT
T
GTGGACCTGTTCAGAGCTTATGATGCGTCACTGGCCATGCTAATGAGGAAAGGACAAGAGAGCATAGAA
CCA
GTTCCAGGTCAAAAGGGGAAAAAAAAACCAGTGGAGCAGCGTGACTTCATTGGAGTGGACAGCACAG
GA
AAAAGGCTGCTCTTTATGGCTAATGAAGCAGACTTGGATGAAGAGCTGGTCATTAAGGGATCCATCCT
G
CAGAAGCACCCTAGGATACATTTCCACACAGGCCTTGTGGATGCCCATCTCTACTGCCTGAAGAAGTAC
GTT
GTGGATTTCTTAATGGAGAATAGGTCAATCACTTCTATCCGAAGCGAACTGATTCCATACCTAGTAA
GA
AAACAGTTTTCCTCAGCTTCCTCACAGCAAAGGCAGGAAGACAAAGAAGAGGATCTAAAGAAAAAGGA
G
CTGAAGTCTTTAGATATTTACAGTTTTATAAAAAAAGACGACACTCTGACCTTGGCTCCCTATGATGCC
TGC
TGGAATGCTTTTCGAGGAGACAAATGGGAAGATTTGTCTAGATCACAGGTCCGCTGCTATGTCCACA
TC
ATGAAAGAAGGACTTTGCTCTCGAGTAAGCACACTGGGACTCTACATGGAAGCCAACAGACAGGTCCC
C
AAATTGCTATCTGTTCTTTGTCCGGAGGAATCAATGATCCATTCATCAGCCCAGATTGTCAACAAACAC
CTG
ATTGGAGCTGATAGCCTCATCGGGCCAGATACACAAATTGGAGAGAAGTCATCTATTAAGCACTCTG
TC
ATTGGCTCATCCTGTGTCATACGAGACAGAACGTCTATTACCAATTGCCTCCTCATGAACTCTGTCAC
C
GTGGAAGAAGGGAGCAGCATCCACGGCAGTGTCATCTGCAACAACGCAGTGATCGAGACGGGCGCAGAG
ATC
AAGAACTGTTTGGTTGGAAGTGGTCAGAGGATTGAAGCCAAAGCTAAACGAATGAACGAGGTGATCG
TG
GGGAATGACCAGCTCATGGAAATCTGA


Translation (452 aa):
MEFQAVVMAVGGGSRMTDLTSSIPKPLLPVGNKPLIWYPLNLLERVGFEEVIVVTTKDVQKALCAEFKMK
M
KLDIVCIPDEADMGTADSLRHIYPKLK
TDVLVLSCDLITDVALHEVVDLFRAYDASLAMLMRKGQESIE
P
VPGQKGKKKP
VEQRDFIGVDSTGKRLLFMANEADLDEELVIKGSILQKHPRIHFHTGLVDAHLYCLKKY
V
VDFLMEN
RSITSIRSELIPYLVRKQFSSASSQQRQEDKEEDLKKKELKSLDIYSFIKKDDTLTLAPYDA
C
WNAFRGDKWEDLSRSQVRCYVHIMKEGLCSRVSTLGLYMEANRQ
VPKLLSVLCPEESMIHSSAQIVNKH
L
IGADSLIGPDTQIGEKSSIKHSVIGSSCVIRDRTSITNCLLMNSVTVEEGSSIHGSVICNNAVIETGAE
I
KNCLVGSGQRIEAK
AKRMNEVIVGNDQLMEI



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser