NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS50921.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
50921.1 Public Mus musculus 3 Vmn2r4 21 106 86 CCDS HistoryNCBI Gene:637053Re-query CCDS DB by CCDS ID:50921.1Re-query CCDS DB by GeneID:637053See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 50921.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000170280 ENSMUSP00000127513 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000170280Link to Ensembl Protein Viewer:ENSMUSP00000127513Re-query CCDS DB by Nucleotide ID:ENSMUST00000170280Re-query CCDS DB by Protein ID:ENSMUSP00000127513
Original member Current member NCBI NM_001104615.1 NP_001098085.1 Accepted alive Link to Nucleotide Sequence:NM_001104615.1Link to Protein Sequence:NP_001098085.1Re-query CCDS DB by Nucleotide ID:NM_001104615Re-query CCDS DB by Protein ID:NP_001098085Link to BLAST:NP_001098085.1

Chromosomal Locations for CCDS 50921.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 3 (NC_000069.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 64388621 64389603 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 64390947 64391070 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 64398365 64398595 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 64406155 64407024 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 64409782 64410048 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2475 nt):
ATGAAAACCATGATCCACACCATCAAGGAGATTAATGAGAGGAAGGATATTTTGCCCAACCACACTCTGG
GC
TACCAGATCTTTGACAACTGTTTCTCCATCACCAAAGCAATGGAGTCATCTTCAGTGTTTCTAACAGG
G
CAGGAGGAATACAAACCTAACTGGAGAAACAGCACTGGAAAATTTCTAGTTGGAATTATTGGAGCAGGA
GGA
TCAACTATGTCAGTTGCTGTTTCAAGAATTGTAGGGATTCATCGTGTACCTCAGGTAGGATATGCTT
CT
TCCTCCTCAATTTTTAGTAATGATTATCAATTTCCATACATTCTTCGCACAATACCCAGTGACAAGTT
C
CAGTCTGAGGCCATCGTAAATCTAATTAGACACTTTGGTTGGGTCTGGGTAGGTGCTATTGCATCTGAT
GAT
GATTATGGAAAATATGGAGTAAAATTCTTTAGGGAAGAAATGGAGAGGGCCAACCTTTGTGTGGCTT
TC
TCTGAAACCATTCCAAAAGTCTACTCCAATGAGAAAATGAAAATAGCTGTTGATGCAGTAAAGAGTTC
C
ACTGCCAAAGTCATTGTGCTTTATGCAACTGACATTGACCTCAGCCCCTTTGTGCTGGAAGTGATTCAT
CAT
AACATAACTGACAGGACATGGATAGCCACCGAAGCCTGGATTACCTCAGCTCTCATTGCAAAGCCTG
AG
TACTTTCCCTATTTTGGTGGAACTATTGGATTTGCAATACCGAGAAGTGTTATACCAGGACTAAAAGA
A
TTCCTTTATGATGTACACCCTAGCAAGGATCCAAATGATGTCTTGACCATTGAATTCTGGCAAACTGCT
TTT
AACTGTACCTGGCCCAACAGCAGTGTGGCTTACAATGTGGACCACAGAGTGAATATGACTGGTAAAG
AA
GACAGACTGTATGACATGTCTGATCAGCTCTGCACTGGAGAGGAGAAGCTGGAAGATCTGAAAAATAC
C
TATCTGGATACATCTCAGCTAAGAATCACAAACAATGTCAGACAAGCTGTGTATCTTTTTGCTCATGCG
ATG
GATATTTTGAGACAAGATGACATAAGAGAAGAATATAGGGAAAAGTCAGTACTTGAAAGTAAATCTA
TC
CTTGATTATATAAAGGTATGGCCGTACATGAAAGAAATAAAATTCGTTACCCATGATGGAAGGAAAAT
A
GAACTTGGTAGTAATGGAGATGTATTAAATGGATCTTATGATATCATCAATTGGCACATGGATAATACT
GGA
GAAATAACCTTTGTCAAAGTTGGAGAATACAAATTCACACGTTCAAAATATGAATTTGTTCTTCCAA
AG
AACTCAACATTATTTTGGAACACTGAATCTTCAAGGCTTCCAGATTCAGTTTGCACAAAAGTGTGTCC
T
CCAGGGACTCGGAAGGGAATTCTCCAGGGACAGCCCATATGCTGCTTTGATTGCATCCCATGTACTGAT
GGA
TATGTGTCAGAGAAACCAGGTCAAAGGCTATGTGATCCATGTGGTGAAAATGACTGGTCCAATGCAG
AG
AAGAACAAGTGTGTGCCAAAGCATGTAGAATTCCTTGCTTATGAGGAGGCCCTGGGGTTCACCCTTGT
C
ATCATTTCCATCTTTGGAGCTCTTGTGGTCTTGGCAGTTACTGTTGTGTATGTGATCCACAGGCACACT
CCA
TTGGTGAAAGCCAATGACCGGGAGCTGAGCTTCCTCATTCAGATGTCTCTGGGAATCACAGTGCTAT
CA
TCCATGTTGTTCATAGGCAAGCCATGCAACTGGTCCTGCAAGACCCGTCAGGTCACTCTGGCACTGGG
C
TTTTGCCTTTGTTTGTCTTCCATTCTTGGAAAGACTGTTTCACTCTTTTTTGCCTACAGGATTTCCATA
TCT
AAAACCCGGCTAATATCCATGCACCCCATTTTTCGTAAACTCATTGTGTTGATCTGTGTTGTAGGGG
AG
ATTGGTGTATGCACAGCTTACTTAGTTTTGGAGCCTCCAAGCCTGTTCAAGAACATTGAACCTCAAAA
T
GTAAAGATCATCTTTGAATGCAATGAAGGTTCTATAGAGTTTCTGTGCTCCATTTTTGGGTTTGATGTT
CTT
CTGGCTCTGCTGTGTTTTGCTACCACCTTTGTGGCTCGCCAGCTGCCAGATAACTATTATGAAGGGA
AA
TGTATCACTTTTGGGATGCTGGTCTTTTTCATTGTCTGGATCTCTTTTGTCCCTGCTTACTTGAGCAC
C
AAAGGCAAATTCAATGTGGCTGTGGAAATATTTGCCATTTTGGCATCTAGCTATGGCTTGTTAGGCTGT
CTA
TTTCTTCCCAAGTGCTTCATTATCTTGCTGAGGCCAAAGAGGAACACTGATGAAACTGTTGGTGGAA
GA
GTCCCCACTGTTGACAGGAGCATCCAGCTGACCTCAGCTTCTGTGAGCAGTGAGCTTAACAGCACCAC
G
GTGTCCACTGTCCTGGATGAGTAG


Translation (824 aa):
MKTMIHTIKEINERKDILPNHTLGYQIFDNCFSITKAMESSSVFLTGQEEYKPNWRNSTGKFLVGIIGAG
G
STMSVAVSRIVGIHRVPQ
VGYASSSSIFSNDYQFPYILRTIPSDKFQSEAIVNLIRHFGWVWVGAIASD
D
DYGKYGVKFFREEMERANLCVAFSETIPKVYSNEKMKIAVDAVKSSTAKVIVLYATDIDLSPFVLEVIH
H
NITDRTWIATEAWITSALIAKPEYFPYFGGTIGFAIPRSVIPGLKEFLYDVHPSKDPNDVLTIEFWQTA
F
NCTWPNSSVAYNVDHRVNMTGKEDRLYDMSDQLCTGEEKLEDLKNTYLDTSQLRITNNVRQAVYLFAHA
M
DILRQDDIREEYREKSVLESKSILDYIK
VWPYMKEIKFVTHDGRKIELGSNGDVLNGSYDIINWHMDNT
G
EITFVKVGEYKFTRSKYEFVLPKNSTLFWNTESSR
LPDSVCTKVCPPGTRKGILQGQPICCFDCIPCTD
G
YVSEKP
GQRLCDPCGENDWSNAEKNKCVPKHVEFLAYEEALGFTLVIISIFGALVVLAVTVVYVIHRHT
P
LVKANDRELSFLIQMSLGITVLSSMLFIGKPCNWSCKTRQVTLALGFCLCLSSILGKTVSLFFAYRISI
S
KTRLISMHPIFRKLIVLICVVGEIGVCTAYLVLEPPSLFKNIEPQNVKIIFECNEGSIEFLCSIFGFDV
L
LALLCFATTFVARQLPDNYYEGKCITFGMLVFFIVWISFVPAYLSTKGKFNVAVEIFAILASSYGLLGC
L
FLPKCFIILLRPKRNTDETVGGRVPTVDRSIQLTSASVSSELNSTTVSTVLDE




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser