NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS50700.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
50700.1 Public Mus musculus 2 Trpm7 21 106 86 CCDS HistoryNCBI Gene:58800Re-query CCDS DB by CCDS ID:50700.1Re-query CCDS DB by GeneID:58800See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 50700.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000028843 ENSMUSP00000028843 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000028843Link to Ensembl Protein Viewer:ENSMUSP00000028843Re-query CCDS DB by Nucleotide ID:ENSMUST00000028843Re-query CCDS DB by Protein ID:ENSMUSP00000028843
Original member Current member EBI,WTSI OTTMUST00000037943 OTTMUSP00000017029 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000037943Link to Vega Protein Viewer:OTTMUSP00000017029Re-query CCDS DB by Nucleotide ID:OTTMUST00000037943Re-query CCDS DB by Protein ID:OTTMUSP00000017029
Original member Current member NCBI NM_001164325.1 NP_001157797.1 Accepted alive Link to Nucleotide Sequence:NM_001164325.1Link to Protein Sequence:NP_001157797.1Re-query CCDS DB by Nucleotide ID:NM_001164325Re-query CCDS DB by Protein ID:NP_001157797Link to BLAST:NP_001157797.1

Chromosomal Locations for CCDS 50700.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 126792826 126792956 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 126795232 126795338 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 126795443 126795494 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 126797111 126797316 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 126797467 126797549 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 126797662 126797945 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 126799169 126799234 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 126799313 126799363 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 126801123 126801148 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 126802586 126802620 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 126805017 126805084 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 126807289 126807379 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 126810163 126810230 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 126812696 126813408 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 126814688 126814820 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 126816760 126816944 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 126819837 126819963 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 126821164 126821338 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 126822470 126822748 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 126823976 126824104 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 126825412 126825555 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 126825634 126825789 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 126826715 126826943 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 126829010 126829290 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 126830129 126830263 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 126831197 126831337 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 126833688 126833741 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 126835456 126835590 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 126837335 126837435 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 126840744 126840816 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 126842856 126842979 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 126844300 126844474 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 126846074 126846245 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 126848497 126848621 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 126849899 126850112 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 126851343 126851541 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 126854643 126854681 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 126858413 126858492 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 126875974 126875976 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (5589 nt):
ATGTCCCAGAAATCCTGGATAGAGAGCACTTTGACCAAGAGGGAGTGTGTATATATTATACCAAGCTCCA
AA
GACCCTCACAGATGTCTTCCAGGATGTCAGATTTGTCAGCAACTTGTCAGATGTTTCTGTGGTCGTTT
G
GTCAAGCAACATGCATGCTTTACTGCAAGTCTTGCCATGAAATACTCAGATGTGAAATTGGGTGAACAC
TTT
AACCAGGCAATAGAAGAATGGTCTGTGGAAAAGCACACGGAGCAGAGCCCAACAGATGCTTATGGAG
TC
ATCAATTTTCAAGGGGGTTCTCATTCCTACAGAGCTAAGTATGTGAGACTATCATATGATACCAAACC
T
GAAATCATTCTGCAACTTCTGCTTAAAGAATGGCAAATGGAGTTACCCAAACTTGTTATTTCTGTACAT
GGA
GGCATGCAGAAGTTTGAACTTCATCCAAGAATCAAGCAGTTGCTTGGAAAGGGTCTTATTAAAGCTG
CA
GTTACAACCGGAGCTTGGATTTTAACTGGAGGAGTCAATACAGGTGTGGCAAAACATGTTGGTGATGC
C
CTCAAAGAACATGCTTCCAGATCATCTCGAAAAATTTGCACTATTGGAATAGCTCCATGGGGAGTGATA
GAA
AACAGAAATGATCTTGTTGGGAGAGATGTGGTTGCTCCTTATCAAACCCTATTGAATCCCTTGAGCA
AA
TTGAATGTTCTGAATAATCTACACTCCCATTTCATCTTGGTGGATGATGGCACTGTTGGAAAGTATGG
G
GCAGAAGTCAGACTGAGAAGAGAACTTGAAAAAACCATTAATCAGCAAAGAATTCATGCTAGAATTGGG
CAA
GGAGTTCCTGTGGTGGCTTTGATATTTGAAGGCGGGCCAAATGTCATCCTTACAGTACTGGAGTACC
TT
CAGGAAAGCCCCCCAGTTCCAGTTGTTGTGTGTGAAGGGACAGGCAGAGCTGCAGATTTACTAGCCTA
T
ATCCACAAACAGACAGAGGAAGGAGGAAATCTTCCTGATGCAGCAGAGCCTGATATTATATCAACTATC
AAG
AAAACATTTAACTTTGGCCAGAGTGAAGCAGTTCATTTATTTCAAACAATGATGGAGTGTATGAAAA
AA
AAAGAGCTTATCACTGTTTTTCACATTGGATCAGAGGATCATCAAGATATAGATGTGGCCATACTCAC
T
GCACTGCTGAAAGGTACTAATGCATCTGCATTTGACCAGCTTATCCTTACACTGGCATGGGACAGAGTT
GAT
ATTGCCAAAAATCATGTATTTGTTTATGGACAACAGTGGCTGGTTGGATCCTTGGAACAGGCTATGC
TT
GATGCTCTTGTAATGGACAGAGTTTCATTTGTAAAACTTCTTATTGAAAACGGAGTAAGCATGCATAA
A
TTCCTTACCATTCCCAGACTGGAAGAACTTTATAACACTAAACAAGGTCCAACCAATCCAATGTTGTTC
CAT
CTCATTCGGGATGTCAAGCAGGGTAATCTCCCCCCGGGGTACAAGATCACTTTAATTGATATAGGAC
TT
GTGATTGAGTATCTCATGGGAGGAACCTACAGATGCACATACACACGAAAACGTTTTCGATTGATATA
T
AATAGTCTTGGTGGAAATAACCGGAGGTCAGGTCGAAATACCTCCAGCAGCACCCCTCAGTTGCGAAAG
AGT
CATGAAACTTTTGGCAATAGAGCTGATAAAAAGGAAAAAATGAGACACAATCATTTCATTAAAACAG
CC
CAACCCTACAGACCAAAGATGGATGCATCTATGGAAGAAGGAAAGAAGAAAAGAACCAAAGATGAAAT
T
GTAGATATAGATGATCCAGAGACCAAGCGCTTTCCTTATCCTCTTAATGAATTATTAATTTGGGCTTGC
CTT
ATGAAGAGGCAGGTCATGGCCCGCTTTTTATGGCAGCATGGTGAAGAATCAATGGCTAAAGCATTAG
TT
GCCTGTAAAATCTATCGTTCAATGGCTTATGAGGCAAAGCAGAGTGACCTGGTAGATGATACTTCAGA
G
GAACTGAAGCAGTATTCCAATGATTTTGGCCAACTGGCAGTTGAATTACTGGAACAGTCCTTCAGACAG
GAT
GAAACGATGGCTATGAAATTACTCACTTATGAACTCAAAAACTGGAGTAATTCAACCTGCCTCAAGT
TA
GCAGTTTCTTCAAGACTTAGACCTTTTGTAGCTCACACTTGTACACAGATGTTGTTATCTGATATGTG
G
ATGGGACGGCTGAATATGAGAAAAAATTCCTGGTATAAGGTCATATTAAGCATTTTAGTTCCACCTGCC
ATA
TTAATGCTAGAGTATAAAACCAAGGCTGAAATGTCCCATATCCCACAATCTCAAGATGCTCATCAAA
TG
ACGATGGAGGATAGTGAAAACAATTTTCACAACATAACAGAAGAGATACCCATGGAAGTATTTAAAGA
A
GTAAAGATTTTGGACAGCAGTGATGGAAAGAATGAAATGGAGATACATATTAAATCAAAAAAGCTTCCA
ATC
ACACGAAAATTTTATGCCTTTTATCATGCACCAATTGTAAAGTTCTGGTTTAACACATTGGCATATT
TA
GGATTTCTGATGCTTTATACATTTGTAGTTCTTGTAAAAATGGAACAGTTACCTTCAGTTCAAGAATG
G
ATTGTTATCGCTTATATTTTTACCTATGCTATTGAAAAAGTCCGTGAGGTCTTCATGTCTGAAGCTGGG
AAA
ATCAGCCAGAAGATTAAAGTATGGTTTAGTGACTACTTCAATGTCAGTGACACAATTGCCATCATTT
CT
TTCTTTGTTGGATTTGGACTAAGATTTGGAGCAAAATGGAACTATATTAATGCATATGATAATCATGT
T
TTTGTGGCTGGAAGATTAATTTACTGTCTTAATATAATATTTTGGTATGTGCGTTTGCTAGACTTTCTA
GCC
GTAAATCAACAGGCAGGACCTTATGTAATGATGATTGGAAAAATGGTGGCCAATATGTTCTACATTG
TA
GTGATAATGGCTCTTGTATTGCTTAGTTTTGGTGTTCCCAGAAAAGCAATACTTTATCCACATGAAGA
A
CCATCTTGGTCTCTTGCTAAAGATATAGTTTTTCATCCATACTGGATGATTTTTGGTGAAGTTTATGCA
TAT
GAAATTGATGTGTGTGCAAATGACTCCACTCTCCCGACAATCTGTGGTCCTGGAACTTGGTTGACTC
CA
TTTCTTCAAGCAGTCTACCTCTTTGTACAGTATATCATTATGGTTAATCTCCTTATCGCATTTTTCAA
T
AATGTATATTTACAAGTGAAGGCAATTTCCAATATTGTATGGAAGTATCAGCGGTATCATTTTATTATG
GCT
TATCATGAAAAACCAGTCCTGCCTCCTCCTCTTATCATCCTCAGCCATATAGTTTCACTGTTTTGCT
GT
GTATGCAAAAGAAGAAAGAAAGATAAGACTTCCGATGGGCCAAAACTTTTCTTAACAGAAGAAGATCA
A
AAGAAACTCCATGATTTTGAAGAGCAGTGTGTTGAGATGTACTTTGATGAGAAAGATGACAAATTCAAT
TCT
GGGAGTGAAGAGAGAATCCGGGTCACTTTTGAAAGAGTGGAGCAGATGAGCATTCAGATTAAAGAAG
TT
GGAGATCGTGTCAACTACATAAAAAGATCATTACAGTCTTTAGATTCTCAAATTGGTCATCTGCAAGA
T
CTCTCAGCCCTAACAGTAGATACATTGAAAACACTTACAGCCCAGAAAGCTTCAGAAGCTAGTAAAGTG
CAC
AATGAGATCACACGAGAATTGAGTATTTCCAAACACTTGGCTCAGAATCTTATTGATGATGTTCCTG
TA
AGACCTTTGTGGAAGAAACCTAGTGCTGTAAACACACTGAGTTCCTCTCTTCCTCAAGGTGATCGGGA
A
AGTAATAATCCTTTTCTTTGTAATATTTTTATGAAAGATGAAAAAGACCCCCAATATAATCTGTTTGGA
CAA
GATTTGCCCGTGATACCCCAGAGAAAAGAATTCAACATTCCAGAGGCTGGTTCCTCCTGTGGTGCCT
TA
TTCCCAAGTGCTGTTTCTCCCCCAGAATTACGACAGAGACGACATGGGGTAGAAATGTTAAAAATATT
T
AATAAAAATCAAAAATTAGGCAGTTCACCTAATAGTTCACCACATATGTCCTCCCCACCAACCAAATTT
TCT
GTGAGTACCCCATCCCAGCCAAGTTGCAAAAGTCACTTGGAATCCACAACCAAAGATCAAGAACCCA
TT
TTCTATAAAGCTGCAGAAGGGGATAACATAGAATTTGGAGCATTTGTGGGACACAGAGATAGTATGGA
C
TTACAGAGGTTTAAAGAAACATCAAACAAAATAAGAGAACTGTTATCTAATGATACTCCTGAAAACACT
CTG
AAACATGTGGGTGCTGCTGGATATAGTGAATGTTGTAAGACTTCTACTTCTCTTCACTCGGTGCAAG
AA
AGCTGTAGTAGAAGAGCGTCGACGGAAGACTCTCCAGAAGTCGATTCTAAAGCAGCTTTGTTACCGGA
T
TGGTTACGAGATAGACCATCAAACAGAGAAATGCCATCTGAAGGAGGAACATTAAATGGTCTTGCTTCT
CCA
TTTAAGCCCGTTTTGGATACAAATTACTATTATTCAGCTGTGGAAAGAAATAACCTGATGAGGTTGT
CA
CAGAGTATTCCCTTCGTTCCTGTACCTCCACGAGGCGAGCCTGTCACAGTGTACCGTCTGGAGGAGAG
T
TCTCCCAGTATACTGAATAACAGCATGTCTTCATGGTCTCAGCTAGGCCTCTGTGCCAAAATTGAGTTT
TTA
AGTAAAGAGGAAATGGGAGGTGGTTTACGAAGAGCAGTCAAAGTGCTGTGTACCTGGTCAGAGCACG
AT
ATCCTGAAGTCAGGGCATCTCTATATCATTAAGTCATTTCTTCCTGAGGTGATAAACACATGGTCAAG
C
ATTTATAAAGAAGATACGGTTCTACATCTCTGTCTCAGAGAAATACAACAACAGAGAGCAGCACAAAAG
CTC
ACATTTGCCTTTAATCAGATGAAACCCAAATCCATACCATATTCTCCAAGGTTCCTTGAAGTTTTCC
TG
TTGTACTGCCATTCAGCAGGGCAGTGGTTTGCTGTAGAAGAGTGCATGACTGGTGAATTTAGAAAATA
C
AACAACAATAATGGTGATGAAATCATTCCTACAAATACTCTAGAAGAGATCATGCTAGCCTTTAGCCAC
TGG
ACCTATGAATATACCAGAGGGGAGTTACTGGTACTTGACTTACAAGGAGTGGGAGAAAACTTGACTG
AC
CCATCTGTAATAAAAGCTGAAGAAAAAAGATCCTGTGACATGGTTTTTGGCCCTGCCAATCTAGGAGA
A
GATGCAATAAAAAACTTCAGAGCCAAACATCACTGTAATTCTTGCTGTCGAAAGCTTAAACTTCCAGAT
TTG
AAGAGGAATGACTACACGCCTGATAAAATTATATTTCCTCAGGATGAGTCATCAGATTTGAATCTTC
AA
TCTGGAAATTCCACCAAAGAATCAGAAGCAACAAATTCTGTTCGTCTGATGTTATAG


Translation (1862 aa):
MSQKSWIESTLTKRECVYIIPSSKDPHRCLPGCQICQQLVRCFCGRLVKQHACFTASLAMKYSDVKLGEH
F
NQAIEEWSVEKHTEQSPTDAYGVINFQGGSHSYRAK
YVRLSYDTKPEIILQLLLKEWQMELPKLVISVH
G
GMQKFELHPRIKQLLGKGLIKAAVTTGAWILTGGVNT
GVAKHVGDALKEHASRSSRKICTIGIAPWGVI
E
NRNDLVGRD
VVAPYQTLLNPLSKLNVLNNLHSHFILVDDGTVGKYGAEVRLRRELEKTINQQRIHARIG
Q
GVPVVALIFEGGPNVILTVLEYLQESPPVPVVVCEGTGRAADLLAYIHKQTEEG
GNLPDAAEPDIISTI
K
KTFNFGQSEAVHLFQTMMECMKKKEL
ITVFHIGSEDHQDIDVAILTALLKGTNASAFDQLILTLAWDRV
D
IAKNHVFVYGQQWL
VGSLEQAMLDALVMDRVSFVKLLIENGVSMHKFLTIPRLEELYNTKQGPTNPMLF
H
LIRDVKQ
GNLPPGYKITLIDIGLVIEYLMGGTYRCTYTRKRFRLIYNSLGGNNRRSGRNTSSSTPQLRK
S
HETFGNRADKKEKMRHNHFIKTAQPYRPK
MDASMEEGKKKRTKDEIVDIDDPETKRFPYPLNELLIWAC
L
MKRQVMARFLWQHGEESMAKALVACKIYRSMAYEAKQSDLVDDTSEELKQYS
NDFGQLAVELLEQSFRQ
D
ETMAMKLLTYELKNWSNSTCLKLAVSSRLRPFVAHTCTQMLLSDMWMGRLNMRKNSWYK
VILSILVPPA
I
LMLEYKTKAEMSHIPQSQDAHQMTMEDSENNFHNITEEIPM
EVFKEVKILDSSDGKNEMEIHIKSKKLP
I
TRKFYAFYHAPIVKFWFNT
LAYLGFLMLYTFVVLVKMEQLPSVQEWIVIAYIFTYAIEKVREVFMSEAG
K
ISQKIKVWFSDYFNVSDTIAIISFFVGFGLRFGAKWNYINAYDNHVFVAGRLIYCLNIIFWYVRLLDFL
A
VNQQAGPYVMMIGKM
VANMFYIVVIMALVLLSFGVPRKAILYPHEEPSWSLAKDIVFHPYWMIFGEVYA
Y
EID
VCANDSTLPTICGPGTWLTPFLQAVYLFVQYIIMVNLLIAFFNNVYLQVKAISNIVWKYQRYHFIM
A
YHEKPVLPPPLIILSHIVSLFCCVCKRRKKDKTSDGP
KLFLTEEDQKKLHDFEEQCVEMYFDEKDDKFN
S
GSEERIRVTFE
RVEQMSIQIKEVGDRVNYIKRSLQSLDSQIGHLQDLSALTVDTLKTLTAQKASEASKV
H
NEITRELSISKHLAQNLIDDVPVRPLWKKPSAVNTLSSSLPQGDRESNNPFLCNIFMKDEKDPQYNLFG
Q
DLPVIPQRKEFNIPEAGSSCGALFPSAVSPPELRQRRHGVEMLKIFNKNQKLGSSPNSSPHMSSPPTKF
S
VSTPSQPSCKSHLESTTKDQEPIFYKAAEGDNIEFGAFV
GHRDSMDLQRFKETSNKIRELLSNDTPENT
L
KHVGAAGYSECCKTSTSLHSVQ
ESCSRRASTEDSPEVDSKAALLPDWLRDRPSNREMPSEGGTLNGLAS
P
FKPVLDTNYYYS
AVERNNLMRLSQSIPFVPVPPRGEPVTVYRLEESSPSILNNSMSSWSQLGLCAKIEF
L
SKEEMGGGLRRAVKVLCTWSEHDILKSGHLYIIKSFLPEVINTWSSIYKEDTVLHLCLR
EIQQQRAAQK
L
TFAFNQMKPKSIPYSP
RFLEVFLLYCHSAGQWFAVEECMTGEFRKYNNNNGDEIIPTNTLEEIMLAFSH
W
TYEYTRGELLVLDLQ
GVGENLTDPSVIKAEEKRSCDMVFGPANLGEDAIKNFRAKHHCNSCCRKLKLPD
L
KRNDYTPDKIIFPQDESSDLNLQSGNSTKESEATNSVRLML




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser